KEGG   Bacillus subtilis subsp. subtilis 168: BSU26790Help
Entry
BSU26790          CDS       T00010                                 

Gene name
aadK
Definition
(RefSeq) aminoglycoside 6-adenylyltransferase
  KO
K05593  aminoglycoside 6-adenylyltransferase [EC:2.7.7.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:bsu01504]
    BSU26790 (aadK)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.-  
     BSU26790 (aadK)
Antimicrobial resistance genes [BR:bsu01504]
 Gene variants
  Aminoglycoside resistance genes
   O-Nucleotidyltransferases
    BSU26790 (aadK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenyl_transf
Motif
Other DBs
NCBI-GeneID: 938061
NCBI-ProteinID: NP_390556
Pasteur: BG11037
BSORF: BG11037
UniProt: P17585
Structure
PDB: 

Position
complement(2735682..2736536)
Genome map
AA seq 284 aa AA seqDB search
MRSEQEMMDIFLDFALNDERIRLVTLEGSRTNRNIPPDNFQDYDISYFVTDVESFKENDQ
WLEIFGKRIMMQKPEDMELFPPELGNWFSYIILFEDGNKLDLTLIPIREAEDYFANNDGL
VKVLLDKDSFINYKVTPNDRQYWIKRPTAREFDDCCNEFWMVSTYVVKGLARNEILFAID
HLNEIVRPNLLRMMAWHIASQKGYSFSMGKNYKFMKRYLSNKEWEELMSTYSVNGYQEMW
KSLFTCYALFRKYSKAVSEGLAYKYPDYDEGITKYTEGIYCSVK
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagtgagcaggaaatgatggacatttttttggactttgctttgaacgatgagaga
atccgattggtcactttggaagggtcacgtacaaacagaaatatccctcctgacaacttc
caagattatgacatctcgtattttgtaactgatgtagaatcttttaaagaaaatgatcag
tggctcgaaatctttgggaagcgcattatgatgcaaaaaccagaagatatggagcttttt
cctcccgaattaggtaattggttttcatacattattctttttgaggatggcaacaaatta
gatctaacccttattccaattcgtgaagcagaagattattttgctaataacgatggtttg
gttaaggtattgcttgataaggattcgttcatcaactataaagtgaccccaaatgatcgc
caatactggataaaaaggccgactgcaagggaatttgatgattgctgtaatgagttctgg
atggtttcgacttacgtagtaaaaggactagcaagaaatgaaatcctttttgccattgac
catttaaatgaaattgtacgtcctaatttattgagaatgatggcctggcatatcgcatct
cagaaagggtattcatttagtatggggaagaactataaatttatgaagcggtacctttca
aataaagaatgggaggaactcatgtctacatattctgtgaatgggtatcaggaaatgtgg
aagtctttatttacttgctatgcattatttagaaagtattcaaaagctgtatcagaaggt
cttgcatataagtatcctgattacgatgaaggtattactaagtatacggaaggtatttat
tgctcagtaaagtga

DBGET integrated database retrieval system