KEGG   Bacillus subtilis subsp. subtilis 168: BSU26810Help
Entry
BSU26810          CDS       T00010                                 

Gene name
yrpC
Definition
(RefSeq) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00471  D-Glutamine and D-glutamate metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BSU26810 (yrpC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
    BSU26810 (yrpC)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     BSU26810 (yrpC)
Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
 Precursor biosynthesis
  Racemase
   BSU26810 (yrpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race PI-TkoII_IV Peripla_BP_1
Motif
Other DBs
NCBI-GeneID: 937619
NCBI-ProteinID: NP_390558
Pasteur: BG12306
BSORF: BG12306
UniProt: O05412
Position
2738308..2739105
Genome map
AA seq 265 aa AA seqDB search
MKIGFFDSGIGGMTVLYEAIKVLPYEDYIFYADTLNVPYGEKSKGKVKEYIFNAAEFLAS
QNIKALVIACNTATSIAIEDLRRNFDFPIIGIEPAVKPAINKCTEERKRVLVVATNLTLK
EEKFHNLVKEIDHHDLVDCLALPGLVEFAENFDFSEDKIIKYLKNELSSFDLKQYGTIVL
GCTHFPFFKNSFEKLFGIKVDMISGSVGTAKQLKKVLADRNQLGKGSGSITFFNSGHKIV
DQEVISKYKRLFEILDETQRSHVGH
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataggattttttgattcaggaattggtggcatgactgtattgtatgaggccata
aaagttcttccttatgaagattacattttttatgcagatacgttaaacgttccatacggt
gaaaaatcaaagggtaaagttaaagaatatattttcaatgcagctgaatttctggccagt
caaaatatcaaagctcttgttattgcgtgtaatacagctactagcattgcgatagaggat
cttcggagaaacttcgactttccgataatcggaatcgaacccgctgtaaagcctgctata
aataaatgtacagaggaaagaaaaagagttctggtagttgctactaatttgacgcttaaa
gaagagaaatttcataatctagttaaagaaattgatcaccatgaccttgttgattgctta
gctcttccaggactagttgaatttgctgagaactttgattttagtgaagacaaaatcatt
aaatatctaaagaacgaactatcttcttttgatctgaaacaatatggaacgattgtgtta
ggatgcactcattttccgtttttcaaaaacagttttgaaaaactgtttgggataaaagtt
gatatgatttcaggcagtgtcggtactgcaaaacagttgaaaaaagttcttgcagatcgt
aaccagcttggtaaaggatcgggctcaatcacctttttcaattctggccataaaattgtg
gaccaagaagtcatatcaaagtacaaaagattgtttgaaatattagatgaaactcaaagg
agtcatgttggacattga

DBGET integrated database retrieval system