KEGG   Bacillus subtilis subsp. subtilis 168: BSU26820Help
Entry
BSU26820          CDS       T00010                                 

Gene name
yrpD
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YrpD
Motif
Other DBs
NCBI-GeneID: 937397
NCBI-ProteinID: NP_390559
Pasteur: BG12307
BSORF: BG12307
UniProt: O05411
Position
2739486..2740193
Genome map
AA seq 235 aa AA seqDB search
MMKKGLLAGALTATVLFGTCAVDVPGIISPKTAEAASQLTDGIGGRAYLNSNGAILVTKI
QLPSSTQVSNGTAYIYSGFSGGTESDIGFQYSDKYNVWKPYMKVGSKGQDQVQYLEGGSQ
FTNTKGFRPGSTVQLTIYKNLNGNTRATYWGTNNAGYNGRLISEISKTNVGSISKWKALA
TVATTGSRQSIKSNFSTSFTNITIDNKAITPVIDTQDFAKVTVSGNSVSLSVVKN
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaaaaggtctgcttgcgggtgcgcttacggcaaccgtgctttttggcacatgt
gcagtagatgtaccgggtattattagtccaaaaaccgcagaagctgcatcacagctaact
gatggaatcggcgggagggcttacttgaacagtaatggtgccattcttgttacgaaaatc
cagcttcctagctccactcaggtttcaaatgggacagcctacatctactctggttttagc
ggaggcacagaatccgatatcgggtttcagtacagtgataaatataatgtatggaaacca
tatatgaaagtcggttcaaaaggacaggatcaggttcagtacctcgaaggaggaagccaa
ttcacgaatacgaaaggcttccgtcccggcagcaccgtacaacttaccatctacaaaaac
cttaacggcaatacccgcgctacatactggggcacgaacaatgccggatacaacggccgt
ctcatttcagaaatcagcaaaacaaatgtcggctccatctcaaaatggaaagcgctcgct
acagttgcaacaacagggtcacgccaatctatcaaatcaaacttttcaacatcttttaca
aacatcaccatcgacaacaaagcaataacacctgtaattgatacacaagacttcgctaaa
gtaacagtctcaggcaacagtgtcagtttatccgttgtcaaaaattaa

DBGET integrated database retrieval system