KEGG   Bacillus subtilis subsp. subtilis 168: BSU26830
Entry
BSU26830          CDS       T00010                                 

Symbol
yrpE
Name
(RefSeq) zinc-binding protein
  KO
K09815  zinc transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU26830 (yrpE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU26830 (yrpE)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Zinc transporter
    BSU26830 (yrpE)
SSDB
Motif
Pfam: ZinT LPAM_1 SelP_N DUF4834 Zip
Other DBs
NCBI-GeneID: 936254
NCBI-ProteinID: NP_390560
Pasteur: BG12308
BSORF: BG12308
UniProt: O05410 A0A6M3ZJG1
Position
complement(2741357..2742112)
AA seq 251 aa
MNILFSKRLGILTIGSLLVLAGCQTSGSSAGESNQTTSSSAVEEDSSKTQEQTSDSHTHE
HSHDHSHAHDEETEKIYEGYFKNSQVKDRLLSDWEGDWQSVYPYLQDGTLDEVFSYKSEH
EGGKTAEEYKEYYKKGYQTDVDRIVIQKDTVTFFKNGKEYSGKYTYDGYEILTYDAGNRG
VRYIFKLAKKAEGLPQYIQFSDHSIYPTKASHYHLYWGDDREALLDEVKNWPTYYPSKMD
GHDIAHEMMAH
NT seq 756 nt   +upstreamnt  +downstreamnt
atgaacattttattttcaaaacggctaggcatattaacgattggttcattactagttttg
gcaggatgtcagacttccggttcttctgcaggtgagtctaatcaaacaacatcatcctca
gcagttgaagaagactcttccaaaacgcaagagcaaacatctgacagtcatacacacgaa
cattctcacgatcatagtcatgcgcatgatgaagaaacagaaaaaatatatgaaggctat
tttaaaaacagccaagtaaaggatcgcttactttctgattgggaaggagattggcaatct
gtatatccatacctgcaagatggtactcttgacgaagtgttttcatataaatcagaacac
gaaggcggcaagacagctgaagaatataaagagtattataaaaaaggctatcaaacagat
gttgaccgtattgtaatccagaaagatactgtaacgttcttcaaaaatggaaaagaatat
tctggtaagtatacgtatgacggatacgaaattctaacctatgatgcgggcaatagaggg
gtaagatacatattcaaactagctaaaaaagcagaagggctgcctcagtatattcagttt
agtgatcatagtatttacccgactaaagctagtcattaccatctctattggggggacgac
cgtgaagctttacttgatgaagtcaaaaactggcctacttactacccgtcaaaaatggat
ggacacgatattgcccatgagatgatggctcattaa

DBGET integrated database retrieval system