KEGG   Bacillus subtilis subsp. subtilis 168: BSU26850Help
Entry
BSU26850          CDS       T00010                                 

Gene name
yrpG
Definition
(RefSeq) oxidoreductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-GeneID: 937611
NCBI-ProteinID: NP_390562
Pasteur: BG12309
BSORF: BG12309
UniProt: O05408
Position
2742909..2743889
Genome map
AA seq 326 aa AA seqDB search
MEYTYLGRTGLRVSRLCLGTMNFGVDTDEKTAFRIMDEALDNGIQFFDTANIYGWGKNAG
LTESIIGKWFAQGGQRREKVVLATKVYEPISDPNDGPNDMRGLSLYKIRRHLEGSLKRLQ
TDHIELYQMHHIDRRTPWDEIWEAFETQVRSGKVDYIGSSNFAGWHLVKAQAEAEKRRFM
GLVTEQHKYSLLERTAEMEVLPAARDLGLGVVAWSPLAGGLLGGKALKSNAGTRTAKRAD
LIEKHRLQLEKFSDLCKELGEKEANVALAWVLANPVLTAPIIGPRTVEQLRDTIKAVEIS
LDKEILRMLNDIFPGPGGETPEAYAW
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtggagtatacctatttagggagaacaggattgcgggtgagccgtttatgtttaggcacg
atgaattttggagttgatacagacgaaaagactgcgttccgtatcatggatgaagcactt
gataacggcattcaattttttgatactgccaatatttacggctggggcaaaaacgcagga
ttgacagagagcatcattggaaaatggtttgcacaaggaggacagcgccgcgagaaagtt
gttctggcgacaaaagtatatgaaccgatttctgatccgaatgacggaccaaatgatatg
aggggcttgtctctatacaaaatcagacgtcatctggaaggatcactgaagcggcttcag
acagatcatatcgaattgtaccaaatgcatcatatcgataggcggacaccgtgggatgag
atatgggaagcttttgagactcaggttcgctccggcaaagtagactatattggatccagt
aattttgcaggctggcatttagttaaagcgcaagctgaagctgaaaaacggcgattcatg
ggactcgtcactgaacagcataagtatagtttattagaacgaacagctgaaatggaagtg
ctgccggctgcacgggatcttggtttaggagtagtggcgtggagtccccttgcaggaggg
cttcttggcgggaaggcattgaaaagcaatgccggaactcgtacagcaaaaagagcagat
ttaattgaaaaacatcgtttgcaactcgagaaattttcagatttatgcaaagaactagga
gaaaaagaagcaaatgtggctttggcatgggtgctggcaaatccagttttaactgcgccg
atcatcggaccacgaacggttgagcagctgcgtgatacgataaaagccgttgaaatcagt
ctggataaggagattctccgcatgttaaatgatatctttcccggacctggaggagagaca
cctgaggcatacgcctggtga

DBGET integrated database retrieval system