KEGG   Bacillus subtilis subsp. subtilis 168: BSU26860Help
Entry
BSU26860          CDS       T00010                                 

Gene name
yraO
Definition
(RefSeq) transporter
  KO
K03300  citrate-Mg2+:H+ or citrate-Ca2+:H+ symporter, CitMHS family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BSU26860 (yraO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CitMHS Na_H_antiporter DctM ThrE
Motif
Other DBs
NCBI-GeneID: 937610
NCBI-ProteinID: NP_390563
Pasteur: BG12279
BSORF: BG12279
UniProt: O05407
Position
complement(2744163..2745479)
Genome map
AA seq 438 aa AA seqDB search
MLTILGFSMVTVFTILIMTKKVSPIVALTITPIVFALIGGFGKGIGDMILEGIQTVASSA
ALLLFAILFFGILIDAGLFDPLIEKILSIVKGDPVKIAIGSAVLAMLIALDGDGTTTYMI
TVSAMLPLYKRIGMNPMVMATLAMLSLSIVSGMTPWGGPATRAISVLGLDPSDFFVPLLP
TMLGGIACVIFLAFLMGRKERNRIGIVQLEPRHITKDSSQSYMAATLESEQLKRPRLIYL
NLFLVISIMVFIVLGTKHPSVLFLIGFVLALTINYPNVKMQKERIAEHSGNAITVVLLVF
SAGVFAGILSGTKMVDAIAGSLISIIPSSMGGFFPVIVALTSIPFTFVLSNDAYYFGMVP
IFAEAASAYGIEPVEIARASIMGQPVHLMSPLVASTVLLVSMLKMDLGSFQRFAVKWAVI
TSLVITLLAIITGAITIL
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcttactattttaggtttttcgatggtaactgtttttacaatattaataatgacaaag
aaagtctcgcctattgttgccttgaccatcactcccattgtttttgctcttattggaggt
tttggtaagggtattggcgacatgattttagaaggaattcaaacagttgcaagttcagcg
gcattgctattgtttgctattctttttttcggaattttaattgatgcaggtttatttgat
ccgctaatagaaaaaattttatctatagtaaagggagaccctgtgaaaatagcgataggg
tctgccgtcttggcaatgcttatcgctttagatggggacggtacaacaacctatatgata
acagtctcagcaatgttacctttgtataaaagaattggtatgaatcccatggttatggcg
acattagcaatgctgtcgttgagtatcgttagcggaatgactccatggggcggaccagct
acaagagcgatttcagtgctgggtttggatccttcagatttctttgtgccattacttccg
accatgcttggaggtattgcttgtgtgatatttctggcttttctaatgggaaggaaagag
aggaatcgaataggcatcgttcaattagagcctagacatataacaaaggacagctctcaa
tcttatatggctgctactttggagagcgaacaattgaaaaggccacgcttaatatatctt
aatttattcctcgttataagtatcatggtgtttattgtgcttggaactaagcatccgtca
gttttatttttaattggttttgttcttgcccttactataaattatccgaatgtaaaaatg
cagaaggagcgaatcgccgagcattctggtaatgccataaccgtggtattattggtattt
tcagcaggagtatttgctggtatattatccgggacaaagatggtggatgccatagcagga
tcattaatatccatcatcccctcatcaatgggagggtttttccccgttattgtagcactc
actagtattccgtttacttttgttttatcaaatgatgcatattactttggtatggtacct
atctttgcagaagctgcctcagcatatggtatagaaccagtagaaattgcaagggcttct
ataatggggcagccggttcatctgatgagtccattggttgcgtcaacagtattgctagta
agcatgcttaaaatggacttggggtcatttcaaaggtttgccgttaagtgggctgtaatt
acatcattagttattacgttgttagcaatcattacaggggctattactattttgtaa

DBGET integrated database retrieval system