KEGG   Bacillus subtilis subsp. subtilis 168: BSU26870Help
Entry
BSU26870          CDS       T00010                                 

Gene name
yraN
Definition
(RefSeq) LysR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 HTH_30 Pallilysin PBP_like_2 HTH_28
Motif
Other DBs
NCBI-GeneID: 937614
NCBI-ProteinID: NP_390564
Pasteur: BG12278
BSORF: BG12278
UniProt: O07906
Position
complement(2745594..2746463)
Genome map
AA seq 289 aa AA seqDB search
MDEKDWILLKILHEEQSVTKTAERLFTSQPSITYRLKKIEEIFGIELFTKRHKGITFTAE
GEHLVAYARRMLQELQDTKDHISNLSKEVQGHLRLGVSSNFAQYKLPKLLREFSTMYPNV
QYSVQTGWSTDVMKLLDAGIVQVGILRGSHRWKGVEERLTREKLHIISKKPITIEQLPFL
PFIKYKTDASLKTIIEDWMHTNLKQAPIIAMEVDRQETCKEMVKHGLGYSIAPEICLQES
DHLYTMELYNAKGKPLMRDTWLMYDQKSLGIKLVKAFIDFLKGEQMVTI
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggatgagaaagattggattttattgaaaattcttcacgaagaacaaagtgtaacaaaa
acagcagaacgattatttacatcacagccttccatcacttatcggttgaaaaagattgag
gagattttcggaattgaattattcaccaaaaggcataaaggaattacctttactgcggaa
ggagaacacttggttgcttatgcaagaagaatgctacaggaacttcaagataccaaagat
catatctctaatctaagcaaagaggtgcaaggacatctaaggctgggggtatcaagcaat
ttcgctcaatataagctccctaagttattaagggaattttccactatgtatcctaatgtc
caatatagtgtacaaacaggctggagcacagatgtcatgaaattattagatgctggtatt
gtacaagtcggtatactgagaggaagccatcgctggaaaggggtggaggaacggctgaca
cgggaaaaattacatatcatctcaaaaaaaccaataacgatagagcaacttcctttttta
ccttttatcaaatataaaacggatgcttctttaaaaacgattatagaagattggatgcat
acgaatctaaaacaagcccccattattgcaatggaagtggatcgacaagagacttgcaaa
gagatggtaaagcatggtcttggttactccatagcaccagaaatttgcctgcaggaatct
gatcatttgtacacaatggaactgtataatgctaagggtaagcctctaatgagagatact
tggctaatgtacgatcaaaaatcattaggaatcaaactcgttaaagcattcattgatttt
ttaaagggtgaacaaatggtaaccatttaa

DBGET integrated database retrieval system