KEGG   Bacillus subtilis subsp. subtilis 168: BSU26880
Entry
BSU26880          CDS       T00010                                 

Gene name
yraM
Definition
(RefSeq) isomerase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: PrpF Pro_racemase
Other DBs
NCBI-GeneID: 936343
NCBI-ProteinID: NP_390565
Pasteur: BG12277
BSORF: BG12277
UniProt: O07931 A0A6M4JNT0
Position
2746608..2747711
AA seq 367 aa
MVKTNVTIMRGGTSKGVFFHESAMPNNKNEWEPFLLDVMGSPDKRQIDGLGGGNSLTSKV
AIIKKAYTSDIDVHYTFGQVSISEEKVDFKGNCGNISAAVGPFAIEEGLVKAKEPMTAVR
ILNTNTNKMIIAEVEVEDGQVKYDGDVTISGVPGSGSPIYLNFHDAAGSVTGHLLPTGNS
SEFLDTSQGQIEVSIIDYANPLVFVEASSIGLDGTELAEEFTDLQLAQFEELRSIAAEKC
GFASRFSATKLSPAVPKLAIVAKPEKYKDSTGAWHSSVEMDLHIRMMSMQKPHQALAVTG
AICTTRALSVEGAIPARIAKNHSTKVRLAHSSGIIETMVEPTGIKIVRTARRIMDGTVYT
HGDYQMM
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggtcaagacgaatgtaacaatcatgagaggcggaacaagcaaaggcgtttttttccac
gaatcagccatgcctaacaataaaaacgaatgggagccctttttgcttgatgtcatggga
agtcctgataaaagacaaatagatggtttgggtggcggtaattcccttactagtaaagtg
gcaataataaagaaagcatatacttcggatattgatgttcactatactttcggtcaagtc
agcatttcggaagaaaaggtggactttaaggggaactgcggaaatatctccgctgctgtt
ggtccatttgctattgaagaaggacttgtaaaagcgaaagaaccaatgactgcggtaagg
atcctgaataccaatacgaataaaatgatcattgcggaagtagaagtggaagacggtcag
gtcaaatatgacggagatgttacgatatctggagtacctggatctggatctccaatctat
ttaaactttcatgatgccgctggttcagttaccggtcatttattgcctactggaaatagt
tcggagtttttagatacaagtcaaggccaaatagaggtgtctattatcgactatgcaaat
ccattagtttttgtggaagcgagcagtatcggcctggatggaacggaacttgcagaagaa
tttactgatctacagttggctcaatttgaagaattaagatccattgcggcagagaaatgc
ggctttgccagtcgattttcagctacaaagttatcgccggctgtccccaaactggctata
gtagcaaaaccagagaaatataaagatagtacaggtgcttggcattcaagcgttgagatg
gacttacacatcaggatgatgtccatgcaaaagccacatcaagcactggctgtcactgga
gcgatatgtacaacaagagccctttcagtggaaggtgcaatccctgcaagaatagcaaaa
aaccactctacaaaggttcggctagctcattcttctggtattattgaaacaatggtggag
cccactggtataaagatcgtccgtaccgcacgacgtattatggacggaacagtttatacg
catggagactatcaaatgatgtag

DBGET integrated database retrieval system