KEGG   Bacillus subtilis subsp. subtilis 168: BSU26890
Entry
BSU26890          CDS       T00010                                 

Symbol
csn
Name
(RefSeq) chitosanase
  KO
K01233  chitosanase [EC:3.2.1.132]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BSU26890 (csn)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.132  chitosanase
     BSU26890 (csn)
SSDB
Motif
Pfam: Glyco_hydro_46
Other DBs
NCBI-GeneID: 936802
NCBI-ProteinID: NP_390566
Pasteur: BG11923
BSORF: BG11923
UniProt: O07921 A0A6M3ZEB4
Structure
Position
complement(2747984..2748817)
AA seq 277 aa
MKISMQKADFWKKAAISLLVFTMFFTLMMSETVFAAGLNKDQKRRAEQLTSIFENGTTEI
QYGYVERLDDGRGYTCGRAGFTTATGDALEVVEVYTKAVPNNKLKKYLPELRRLAKEESD
DTSNLKGFASAWKSLANDKEFRAAQDKVNDHLYYQPAMKRSDNAGLKTALARAVMYDTVI
QHGDGDDPDSFYALIKRTNKKAGGSPKDGIDEKKWLNKFLDVRYDDLMNPANHDTRDEWR
ESVARVDVLRSIAKENNYNLNGPIHVRSNEYGNFVIK
NT seq 834 nt   +upstreamnt  +downstreamnt
atgaaaatcagtatgcaaaaagcagatttttggaaaaaagcagcgatctcattacttgtt
ttcaccatgttttttaccctgatgatgagcgaaacggtttttgcggcgggactgaataaa
gatcaaaagcgccgggcggaacagctgacaagtatctttgaaaacggcacaacggagatc
caatatggatatgtagagcgattggatgacgggcgaggctatacatgcggacgggcaggc
tttacaacggctaccggggatgcattggaagtagtggaagtatacacaaaggcagttccg
aataacaaactgaaaaagtatctgcctgaattgcgccgtctggccaaggaagaaagcgat
gatacaagcaatctcaagggattcgcttctgcctggaagtcgcttgcaaatgataaggaa
tttcgcgccgctcaagacaaagtaaatgaccatttgtattatcagcctgccatgaaacga
tcggataatgccggactaaaaacagcattggcaagagctgtgatgtacgatacggttatt
cagcatggcgatggtgatgaccctgactctttttatgccttgattaaacgtacgaacaaa
aaagcgggcggatcacctaaagacggaatagacgagaagaagtggttgaataaattcttg
gacgtacgctatgacgatctgatgaatccggccaatcatgacacccgtgacgaatggaga
gaatcagttgcccgtgtggacgtgcttcgctctatcgccaaggagaacaactataatcta
aacggaccgattcatgttcgttcaaacgagtacggtaattttgtaatcaaataa

DBGET integrated database retrieval system