KEGG   Bacillus subtilis subsp. subtilis 168: BSU26900Help
Entry
BSU26900          CDS       T00010                                 

Gene name
yraL
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mor HTH_23 Sigma70_r4 E3_UbLigase_EDD
Motif
Other DBs
NCBI-GeneID: 937608
NCBI-ProteinID: NP_390567
Pasteur: BG12276
BSORF: BG12276
UniProt: O07917
Position
2749260..2749523
Genome map
AA seq 87 aa AA seqDB search
MAYVKATAILPEKLISEIQKYVQGKTIYIPKPESSHQKWGACSGTRKLIDDRNASIKKAF
KNGKTIHQLSDEYHLSIETIKKIVYSK
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atggcatatgtaaaagcaaccgctattttacctgaaaagctgatatcggaaattcaaaag
tatgttcaaggaaaaacaatatatatccctaaacctgaatcctctcatcaaaaatggggt
gcgtgttcaggaacaagaaagctgatcgatgacagaaacgcttctattaaaaaagcattt
aaaaacggcaaaaccattcatcaattatctgatgaatatcacctctctattgaaacaata
aaaaaaattgtctactctaaataa

DBGET integrated database retrieval system