KEGG   Bacillus subtilis subsp. subtilis 168: BSU26900
Entry
BSU26900          CDS       T00010                                 

Symbol
yraL
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Mor Sigma70_r4 HTH_23 E3_UbLigase_EDD
Other DBs
NCBI-GeneID: 937608
NCBI-ProteinID: NP_390567
Pasteur: BG12276
BSORF: BG12276
UniProt: O07917 A0A6M4JJN6
Position
2749260..2749523
AA seq 87 aa
MAYVKATAILPEKLISEIQKYVQGKTIYIPKPESSHQKWGACSGTRKLIDDRNASIKKAF
KNGKTIHQLSDEYHLSIETIKKIVYSK
NT seq 264 nt   +upstreamnt  +downstreamnt
atggcatatgtaaaagcaaccgctattttacctgaaaagctgatatcggaaattcaaaag
tatgttcaaggaaaaacaatatatatccctaaacctgaatcctctcatcaaaaatggggt
gcgtgttcaggaacaagaaagctgatcgatgacagaaacgcttctattaaaaaagcattt
aaaaacggcaaaaccattcatcaattatctgatgaatatcacctctctattgaaacaata
aaaaaaattgtctactctaaataa

DBGET integrated database retrieval system