KEGG   Bacillus subtilis subsp. subtilis 168: BSU26910
Entry
BSU26910          CDS       T00010                                 

Symbol
yraK
Name
(RefSeq) hydrolase YraK
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Abhydrolase_6 Thioesterase Patatin
Other DBs
NCBI-GeneID: 936746
NCBI-ProteinID: NP_390568
Pasteur: BG12275
BSORF: BG12275
UniProt: O07937 A0A6M3ZHP6
Position
2749660..2750475
AA seq 271 aa
MTINNGTLQVPGANIHYQVRGSGPIILLVHGGGGDADKFHHVANHLANWYTVVTYDRRGH
SRSNLANQIEGYRVETHSDDAHRLLAKITNKPAYVFGSSSGAVIGLDLCIRHPEQVHVMI
PHEPILLQLLHGNELKQAEQFMEDLKKNHRSEVIKLMSRLETDEQSKAVLTKRLLGNSTY
FTEYEIQGILSYTLDFEALKTVFTSSPMKILPAGGSASRELFPYRCANALAEQLETEWVE
FPGNHTGYTMYHKEFSERLHDMLEKEKKHTC
NT seq 816 nt   +upstreamnt  +downstreamnt
atgacgataaacaatggaacgttgcaagtacccggcgcgaacatccactatcaggtgcgt
ggctctggtccaatcattcttttggtccacggaggaggcggtgatgccgacaagttccat
catgttgccaatcatctggctaactggtacacggttgttacttatgatcgccgcggccat
tcccgcagcaatctcgccaatcagattgagggttaccgtgtggaaacacacagtgacgat
gctcaccgtcttctagccaaaatcaccaataagccggcctatgtatttggaagcagctcc
ggggctgttatcgggcttgatctgtgcatacgccatcccgaacaagtacatgtcatgatc
ccacacgaaccaatcttattgcagcttctgcatggaaatgagctgaaacaagccgagcaa
ttcatggaagaccttaagaaaaatcatcgaagtgaagtcattaaattaatgtcaagatta
gagacagacgaacaatcaaaggctgtcctgacaaagcggcttctcggcaattcaacgtat
ttcactgagtatgaaattcaaggaattctcagctatacattagatttcgaagcattaaaa
actgtgtttacatcttcaccgatgaagatactcccagctggcggaagtgcttctcgggag
ctttttccttatcgttgcgcgaacgccctagcggaacaattggaaacagaatgggttgaa
ttccccggaaatcatacggggtacacaatgtaccataaagaattttctgagaggttacac
gacatgttagaaaaagaaaagaaacatacgtgttaa

DBGET integrated database retrieval system