KEGG   Bacillus subtilis subsp. subtilis 168: BSU26920Help
Entry
BSU26920          CDS       T00010                                 

Gene name
yraJ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SH3_3
Motif
Other DBs
NCBI-GeneID: 937609
NCBI-ProteinID: NP_390569
Pasteur: BG12274
BSORF: BG12274
UniProt: O07934
Position
complement(2750883..2751239)
Genome map
AA seq 118 aa AA seqDB search
MTKLKMLSMLTVMIASLFIFSSQALAVQYFTVSTSSGAPVNMRSGPGTNYPIMLSIPSGS
RVPYYCYAYGTTVTGKYGTSNIWDQIQWKDSRGVVNIGYVSDTYVYTGSDGPVGYKCN
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
ttgactaaactgaaaatgctgagtatgttaaccgtgatgattgcatctttattcattttt
tccagtcaggcacttgccgttcagtactttactgtctcaacaagcagcggtgcgcctgtc
aatatgcgcagcggtcctggtacaaattatcctattatgctttccattccgagtggctcc
cgtgttccttattattgttacgcttatggaacgactgttacagggaagtatggaacgagt
aatatctgggaccaaatccagtggaaagattcccggggtgtcgtgaatattggatatgtg
tctgacacatatgtgtacacaggttcagacggccctgtcggttacaaatgcaattag

DBGET integrated database retrieval system