KEGG   Bacillus subtilis subsp. subtilis 168: BSU26930
Entry
BSU26930          CDS       T00010                                 

Symbol
yraI
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: SH3_3
Other DBs
NCBI-GeneID: 936030
NCBI-ProteinID: NP_390570
Pasteur: BG12273
BSORF: BG12273
UniProt: O07909 A0A6M4JM69
Position
complement(2751292..2751726)
AA seq 144 aa
MVSESKSLTGCKKVKRTAFIRGGYKVNKLKRLSMLTVMIASVFIFSSHALAAQYYTVSTS
SGAPVNMRSGPGTSWGIVTTIPSGTRIPIYCYKTGTTVTGKYGTSNIWNYTERTLASGEI
VPGFVSDTYMYTGSDGPVVPKCSW
NT seq 435 nt   +upstreamnt  +downstreamnt
atggtatctgaaagtaaatccttaactggatgtaagaaagtcaaacgtacggcatttata
aggggagggtataaggtgaataagttaaagaggctaagtatgctaacggtgatgattgca
tctgtgttcattttttctagccatgcacttgcggctcagtattatacggtttcaacaagc
agcggtgctcctgtcaacatgcgcagcggcccaggtacaagttggggaattgtaacgacc
attccgagcggaacccgcatcccgatctattgctacaaaaccggtacaactgtaactgga
aagtatggaacgagcaatatttggaattacacagagcggacgcttgccagcggggagatc
gttcctggatttgtctctgatacatatatgtatacaggctcagacggtccggttgttcct
aaatgcagctggtag

DBGET integrated database retrieval system