KEGG   Bacillus subtilis subsp. subtilis 168: BSU26940Help
Entry
BSU26940          CDS       T00010                                 

Gene name
yraH
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase Glyoxalase_2 Glyoxalase_4
Motif
Other DBs
NCBI-GeneID: 937607
NCBI-ProteinID: NP_390571
Pasteur: BG12272
BSORF: BG12272
UniProt: O07918
Position
complement(2752167..2752553)
Genome map
AA seq 128 aa AA seqDB search
MKLLQIRLLVNDFKKSVEFYKDSLGLPISWLENEMEYALFDNGETKIELLSRETMAEIVG
EEKKSLEGEAQSKFLLQFKVEDVDKTYDDLHEKGVKCENKPHDRKEWSARVAHFRDPDHN
LIEIYKML
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgttacaaattagactgttggtgaatgattttaagaaaagcgtcgagttttat
aaagattcattaggacttccaataagttggttagagaatgaaatggaatatgcactcttt
gataatggggaaacgaaaatagagcttttatctcgagaaacgatggctgaaatcgttgga
gaggaaaaaaagtccttggaaggagaagctcaatcaaaatttttgcttcagtttaaggta
gaagatgttgataaaacgtatgacgatttacacgaaaaaggagttaaatgtgagaataaa
ccgcatgatcgcaaggaatggagtgcccgagttgctcacttcagagatccagatcataat
ctgattgaaatatataaaatgttatga

DBGET integrated database retrieval system