KEGG   Bacillus subtilis subsp. subtilis 168: BSU26950
Entry
BSU26950          CDS       T00010                                 

Symbol
yraG
Name
(RefSeq) spore coat protein F
  KO
K06440  similar to spore coat protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU26950 (yraG)
SSDB
Motif
Pfam: DUF3231
Other DBs
NCBI-GeneID: 936783
NCBI-ProteinID: NP_390572
Pasteur: BG12271
BSORF: BG12271
UniProt: O07919 A0A6M3ZES1
Position
2752802..2753047
AA seq 81 aa
MDHQTLAAHEAVDLHEIVNFKTLCIAKSKLMQGLVFDQELKDLMEKDVQQSIQDLTELQA
VYERASFQAPVPQSRPTPIIN
NT seq 246 nt   +upstreamnt  +downstreamnt
atggatcatcaaacattggcagctcatgaggctgttgacttacatgaaatcgtgaacttt
aaaacactttgtatagcgaaatcaaagttaatgcaagggcttgtgtttgaccaagaactg
aaggacttgatggaaaaagatgtacagcaatccattcaagaccttactgaattacaagcg
gtttatgagcgtgcctcatttcaggcccctgtccctcaaagccgcccaacgccaatcatc
aattga

DBGET integrated database retrieval system