KEGG   Bacillus subtilis subsp. subtilis 168: BSU26960
Entry
BSU26960          CDS       T00010                                 

Symbol
yraF
Name
(RefSeq) spore coat protein F
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Coat_F DUF3231
Other DBs
NCBI-GeneID: 937606
NCBI-ProteinID: NP_390573
Pasteur: BG12270
BSORF: BG12270
UniProt: O07949 A0A6M4JK16
Position
2753065..2753433
AA seq 122 aa
MNNDHLDPINSLNVPELADTTFAMDFLIRAKEGVRNTAVALTETASPDVRALLRKQLMQG
IAMHQEITELMISKKWFHPYELSEQYKLDQLSAKNTIMVGNMNLFPDETNRKGMFDRTPD
EH
NT seq 369 nt   +upstreamnt  +downstreamnt
ttgaataatgatcatttagaccccattaattcgctgaatgtgcctgaactagcagacact
acattcgcgatggattttcttatacgagctaaggaaggcgtaaggaatactgctgtagct
ttgacagaaaccgcttcaccagatgtaagagcactgcttcggaaacagctgatgcaagga
attgcgatgcaccaagagattacggaactgatgatcagcaaaaagtggttccatccatat
gagctgagcgaacagtataagctggatcagctctctgcaaaaaacacgatcatggtcggc
aatatgaacctctttcctgatgaaacaaatcgcaaagggatgtttgaccggacacctgat
gaacactaa

DBGET integrated database retrieval system