KEGG   Bacillus subtilis subsp. subtilis 168: BSU26980
Entry
BSU26980          CDS       T00010                                 

Symbol
yraE
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF892
Other DBs
NCBI-GeneID: 938108
NCBI-ProteinID: NP_390575
Pasteur: BG13780
BSORF: BG13780
UniProt: O06011 A0A6M4JNJ9
Position
2754607..2754804
AA seq 65 aa
MEYALHEVLEVQEMTAFKTLCLTKSKTMKALVSDPKLKEIMQQDVDITTRQLQEFASILS
NAKQE
NT seq 198 nt   +upstreamnt  +downstreamnt
atggaatacgccttacacgaagtgcttgaggttcaggaaatgactgcatttaagacactt
tgtttgacgaaatctaaaacaatgaaagcactggtatctgatccgaagctgaaagaaatc
atgcagcaagatgttgatatcaccacacgccagttgcaggaatttgcctctattttatct
aatgcaaagcaagaatga

DBGET integrated database retrieval system