KEGG   Bacillus subtilis subsp. subtilis 168: BSU26990Help
Entry
BSU26990          CDS       T00010                                 

Gene name
yraD
Definition
(RefSeq) spore coat protein F
  KO
K06439  similar to spore coat protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU26990 (yraD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Coat_F DUF3231 DUF2383
Motif
Other DBs
NCBI-GeneID: 935919
NCBI-ProteinID: NP_390576
Pasteur: BG13779
BSORF: BG13779
UniProt: O06010
Position
2754820..2755119
Genome map
AA seq 99 aa AA seqDB search
MNPIIEYLTGMNVLTDQIIAMDLLISAKNGVRNYAMAATEAGTPEVKEVLIRHLEEALDM
HEQLSSYMMEKGWYHPWNPDEQVKLNLKNIDTAIQLPTL
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctatcatagaatatctgactggcatgaatgttctaacagaccaaatcattgct
atggacttattaatttcagcaaagaacggagtcagaaattatgcgatggcagccactgaa
gccggaacgcctgaagtaaaagaggtccttatccgccatttggaagaagcactcgatatg
cacgaacaactctcaagctatatgatggaaaaaggctggtaccatccttggaaccctgac
gaacaagtcaagctgaatttaaaaaatattgatacagccattcaattgccaaccctttaa

DBGET integrated database retrieval system