KEGG   Bacillus subtilis subsp. subtilis 168: BSU27010Help
Entry
BSU27010          CDS       T00010                                 

Gene name
adhA
Definition
(RefSeq) formaldehyde dehydrogenase AdhA
  KO
K13979  uncharacterized zinc-type alcohol dehydrogenase-like protein [EC:1.-.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU27010 (adhA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     BSU27010 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C NAD_binding_2 Shikimate_DH NAD_binding_7 IGFBP 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 938739
NCBI-ProteinID: NP_390579
Pasteur: BG12562
BSORF: BG12562
UniProt: C0SPA5
Position
2756312..2757361
Genome map
AA seq 349 aa AA seqDB search
MCNQHQTRVLSVSHAKAKFEQTTIERRGLRPHDVLIDIKFSGICHSDIHSAFDEWGGGIF
PMVPGHEIAGVVTAVGTKVTKLAVGDRVGVGCFVDSCGECEYCLNAEEQFCTKGVVQTYN
SVDYDGNPTYGGYSQKIVVTDRFVVRIPDRLEMDVASPLLCAGITTYSPLKHWNVGPGKK
VAIVGVGGLGHLAIQFAHAMGAEVTVLSRSMNKKEEALELGANHYFATSDPATFTALAGR
FDVILNTVSANLDVDAYLSMLRIDGTLVSVGAPAKPDTYSVFSLIMGRRSIAGSLVGGIQ
ETQEMLDFAAEHGIEPKIEVIGADQVDEAYERILRSDVRYRFVIDISTL
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaatcaacatcaaacccgtgtattaagcgtgtcacatgcaaaagccaaatttgaa
caaacgacgattgagcgaagaggattacggccgcacgatgtcttaatcgatattaaattc
agcggcatttgccattcagacattcatagcgcttttgatgaatggggcggtggcatcttc
ccaatggtgcctggacatgaaatagccggtgttgtaacagccgttggaacaaaagtcacc
aagttggctgtcggggaccgcgttggtgtcggctgttttgttgactcttgcggagaatgc
gaatactgtctcaacgcagaggaacaattctgcacgaagggtgttgttcaaacgtataac
tcagtagactacgacggaaaccccacttatggcgggtacagccaaaaaatcgttgtcact
gacagatttgttgttcgcataccagatcgtttggaaatggatgttgccagtccgctgttg
tgtgcaggtatcacaacgtattccccgctgaaacactggaatgttggccctggtaaaaag
gttgcgattgtaggcgtaggtggccttggacatttggcaattcaatttgcacatgcgatg
ggtgcagaagtaaccgtcctgagccgttccatgaataagaaagaggaagctctggaactc
ggtgcaaatcattactttgcaacaagtgacccagccacattcactgcattggccgggcgt
tttgacgtgatcttaaatacggtatcggcaaatctcgatgtagatgcctatttatcaatg
cttcgtatagacgggacacttgtaagcgttggagctcctgccaagccggacacatacagt
gtgttttccctaatcatggggcgccgcagcattgcaggttctctagtcggcggaattcaa
gaaactcaagagatgctggatttcgcagctgagcatggcatcgaacctaaaatcgaagtc
atcggagctgaccaagtggacgaggcatacgaacgtatcctccgaagcgatgtccgttat
cgatttgtgattgatatttccacattgtaa

DBGET integrated database retrieval system