KEGG   Bacillus subtilis subsp. subtilis 168: BSU27020
Entry
BSU27020          CDS       T00010                                 

Symbol
yraA
Name
(RefSeq) cysteine protease YraA
  KO
K05520  protease I [EC:3.5.1.124]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU27020 (yraA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.124  protein deglycase
     BSU27020 (yraA)
Peptidases and inhibitors [BR:bsu01002]
 Cysteine peptidases
  Family C56: PfpI endopeptidase family
   BSU27020 (yraA)
SSDB
Motif
Pfam: DJ-1_PfpI GATase GATase_3 SNO GATase_5 Catalase_C Peptidase_C26
Other DBs
NCBI-GeneID: 937603
NCBI-ProteinID: NP_390580
Pasteur: BG13776
BSORF: BG13776
UniProt: O06006 A0A6M4JLW9
Position
2757492..2758001
AA seq 169 aa
MSKKIAVLVTDQFEDIEYTSPVKAYEEAGYSVVAIDLEAGKEVTGKHGEKVKIDKAISDV
DASDFDALLIPGGFSPDLLRADDRPGEFAKAFVENKKPVFAICHGPQVLIDTDLLKGKDI
TGYRSIRKDLINAGANYKDAEVVVSHNIVTSRTPDDLEAFNRESLNLLK
NT seq 510 nt   +upstreamnt  +downstreamnt
atgagcaaaaaaattgcagttcttgttacagaccaattcgaagacatcgaatatacaagt
ccggtaaaagcatacgaagaagctggctacagtgttgtggctatcgatttggaagccggc
aaagaagttaccggtaagcatggcgagaaagtaaagattgacaaagccatctctgatgtg
gatgcaagtgactttgatgcacttttaattcctgggggattctctccggatttgcttcgt
gcagatgaccgtccgggtgaattcgcaaaagcatttgtcgaaaacaaaaaacctgttttc
gcaatttgccacggcccgcaagtactgattgatacggatcttctaaaaggcaaagatatc
acaggctaccgcagcatccgcaaagatttaatcaatgccggtgcaaactacaaagatgca
gaagtagtcgtcagccacaacattgtcacaagcagaacacctgatgatttggaagcattt
aaccgcgaatctttaaacttgttaaaataa

DBGET integrated database retrieval system