KEGG   Bacillus subtilis subsp. subtilis 168: BSU27030Help
Entry
BSU27030          CDS       T00010                                 

Gene name
sacC
Definition
(RefSeq) levanase
  KO
K03332  fructan beta-fructosidase [EC:3.2.1.80]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00051  Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BSU27030 (sacC)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.80  fructan beta-fructosidase
     BSU27030 (sacC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C BspA_v
Motif
Other DBs
NCBI-GeneID: 938092
NCBI-ProteinID: NP_390581
Pasteur: BG10320
BSORF: BG10320
UniProt: P05656
Structure
PDB: 

Position
complement(2758043..2760076)
Genome map
AA seq 677 aa AA seqDB search
MKKRLIQVMIMFTLLLTMAFSADAADSSYYDEDYRPQYHFTPEANWMNDPNGMVYYAGEY
HLFYQYHPYGLQWGPMHWGHAVSKDLVTWEHLPVALYPDEKGTIFSGSAVVDKNNTSGFQ
TGKEKPLVAIYTQDREGHQVQSIAYSNDKGRTWTKYAGNPVIPNPGKKDFRDPKVFWYEK
EKKWVMVLAAGDRILIYTSKNLKQWTYASEFGQDQGSHGGVWECPDLFELPVDGNPNQKK
WVMQVSVGNGAVSGGSGMQYFVGDFDGTHFKNENPPNKVLWTDYGRDFYAAVSWSDIPST
DSRRLWLGWMSNWQYANDVPTSPWRSATSIPRELKLKAFTEGVRVVQTPVKELETIRGTS
KKWKNLTISPASHNVLAGQSGDAYEINAEFKVSPGSAAEFGFKVRTGENQFTKVGYDRRN
AKLFVDRSESGNDTFNPAFNTGKETAPLKPVNGKVKLRIFVDRSSVEVFGNDGKQVITDI
ILPDRSSKGLELYAANGGVKVKSLTIHPLKKVWGTTPFMSNMTGWTTVNGTWADTIEGKQ
GRSDGDSFILSSASGSDFTYESDITIKDGNGRGAGALMFRSDKDAKNGYLANVDAKHDLV
KFFKFENGAASVIAEYKTPIDVNKKYHLKTEAEGDRFKIYLDDRLVIDAHDSVFSEGQFG
LNVWDATAVFQNVTKES
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagagactgattcaagtcatgatcatgttcaccctgctgttgactatggcattt
tcggcagatgcagccgattcaagctactatgatgaggattaccgtcctcaatatcacttc
acaccggaggcaaactggatgaatgacccaaacggaatggtatattatgctggggaatat
cacttgttctatcaataccatccatacgggcttcagtgggggcccatgcattgggggcat
gccgtcagcaaagatttggttacatgggaacaccttcctgttgcgctgtatccggatgaa
aaaggcacgatcttttctggaagcgcagttgtagataaaaataacacaagcggttttcaa
acaggcaaagagaagccgcttgtggccatttatacacaggatcgggaaggccatcaagtg
caaagtattgcctatagcaacgacaaaggaagaacatggacgaagtacgctggcaaccct
gtcattccaaacccgggtaaaaaagattttcgcgatccaaaagtcttttggtatgagaaa
gaaaaaaagtgggtgatggtgcttgcggccggtgaccgaatcctcatttatacatcaaaa
aatctgaagcagtggacgtatgcaagtgaatttggacaggatcaaggaagccacggggga
gtatgggaatgcccggatttatttgagcttccggtagacggcaatccgaatcaaaagaaa
tgggtcatgcaggtcagtgtcggaaacggagcggtctcgggaggatcaggcatgcaatat
tttgtaggggactttgatggaactcattttaaaaatgaaaacccgccaaacaaagttctc
tggacggattacggcagagacttttatgcggctgtatcctggtctgatattccatccaca
gacagccgccggctatggttagggtggatgagcaattggcaatatgcgaatgatgttccg
acatccccatggagaagtgcaacgtccattccaagagagttaaaattgaaagcgtttacc
gaaggggttagagtggtccaaacaccggtgaaagagctggaaaccattcgcggaacctct
aagaagtggaagaatctgaccatatcgcctgcaagtcataatgtgttagcggggcaatct
ggagatgcctatgaaataaatgcagaatttaaagtaagccctggttcagctgctgaattt
ggttttaaggtccgaacaggtgaaaatcaatttacgaaggtcggctatgaccgaaggaac
gccaaattgttcgttgaccggagcgagtcaggcaacgacacctttaatccggcctttaac
accggaaaagaaacagccccgttgaagccggtaaatgggaaggttaagttgcgcattttt
gttgaccgctcctcggttgaagtatttgggaatgacggaaagcaggtcataacggatatt
attctcccagaccgatcaagcaaagggcttgaattatatgctgcaaatggcggtgtaaag
gtaaaatctttaacgatacaccctttaaaaaaggtatggggaacgacaccttttatgtcc
aatatgactggctggacgactgtaaatggcacgtgggcagacacaattgaggggaaacaa
gggaggtcggacggcgattcctttatcttgtcttcagcatccgggtcagacttcacttat
gaatctgatatcaccattaaggatggaaacggaagaggggcaggagcactaatgtttcgc
tctgacaaagatgccaaaaacggttaccttgccaatgtggatgcgaagcatgacctagtg
aaattctttaaatttgagaacggtgctgcttctgtcattgctgaatacaaaacaccgata
gacgttaataaaaagtatcatctgaaaacagaggccgagggcgatcgctttaaaatctat
ttagatgatcgtcttgtgattgatgcacatgattccgtattttcagaaggccaatttggc
ttgaatgtgtgggacgcgactgctgtctttcagaatgtaacgaaggagtcttaa

DBGET integrated database retrieval system