KEGG   Bacillus subtilis subsp. subtilis 168: BSU27060
Entry
BSU27060          CDS       T00010                                 

Symbol
levE
Name
(RefSeq) PTS system-fructose-specific transporter subunit IIB
  KO
K11195  fructose PTS system EIIB component [EC:2.7.1.202]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00051  Fructose and mannose metabolism
bsu02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BSU27060 (levE)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSU27060 (levE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU27060 (levE)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     BSU27060 (levE)
Transporters [BR:bsu02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BSU27060 (levE)
SSDB
Motif
Pfam: PTSIIB_sorb Msg2_C
Other DBs
NCBI-GeneID: 937078
NCBI-ProteinID: NP_390584
Pasteur: BG10317
BSORF: BG10317
UniProt: P26380 A0A6M3ZJK6
Structure
Position
complement(2761907..2762395)
AA seq 162 aa
MNIVLARIDDRFIHGQILTRWIKVHAADRIIVVSDDIAQDEMRKTLILSVAPSNVKASAV
SVSKMAKAFHSPRYEGVTAMLLFENPSDIVSLIEAGVPIKTVNVGGMRFENHRRQITKSV
SVTEQDIKAFETLSDKGVKLELRQLPSDASEDFVQILRNVTK
NT seq 489 nt   +upstreamnt  +downstreamnt
atgaacattgtgttagcaagaattgatgaccgctttattcacggccaaatcctgacaagg
tggataaaagtccatgcagccgaccgaatcatcgttgtctccgacgatattgctcaggac
gaaatgagaaaaacgctgatcctttctgttgcgccttcaaatgtaaaggcgagtgccgtc
tcggtttctaaaatggcaaaagcatttcatagtccgcgctacgaaggggtaacggcaatg
ctcttgtttgaaaatccgtccgatattgtatctcttatagaagcaggtgtaccgatcaaa
accgtaaacgtcgggggaatgcgttttgaaaatcatcgcaggcaaatcacaaaatcagtc
agtgtcacagaacaagatataaaggcatttgaaacattaagtgacaagggcgtgaaactg
gaattgaggcagctgccttcagatgccagtgaggattttgtacagattttacggaacgta
acaaaataa

DBGET integrated database retrieval system