KEGG   Bacillus subtilis subsp. subtilis 168: BSU27100
Entry
BSU27100          CDS       T00010                                 

Symbol
yrhP
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: LysE Claudin_2 TerC DUF485 DUF4413 DUF679
Other DBs
NCBI-GeneID: 937592
NCBI-ProteinID: NP_390588
Pasteur: BG12304
BSORF: BG12304
UniProt: O05406 A0A6M3ZES3
Position
complement(2768042..2768674)
AA seq 210 aa
MHSLLAYIPIAAMMVIIPGADTMLVMKNTLRYGPKAGRYNILGLATGLSFWTVIAILGLS
VVIAKSVILFTTIKYLGAAYLIYLGVKSFFAKSMFSLDDMQSQAKNMASSPKRYYKTSFM
QGSLSNILNPKTVLVYVTIMPQFINLNGNINQQLIILASILTLLAVLWFLFLVYIIDYAK
KWMKNSKFQKVFQKITGIILVGFGIKTGLS
NT seq 633 nt   +upstreamnt  +downstreamnt
atgcacagcttactcgcatacataccgatcgctgccatgatggttatcataccgggggca
gatacgatgcttgtgatgaaaaatacgcttaggtatggtccgaaagccggccgttataac
attctcggattggcgacaggactttccttttggacggtgattgccattttaggattatca
gtggtaatcgcaaagtcagtgattcttttcacaacgatcaaatatttgggagcggcatac
ttaatttatttaggtgtaaaaagtttttttgctaaaagtatgttttcgttagatgacatg
caatcccaagcaaaaaatatggcaagttctccgaaacgttattataaaacttcctttatg
cagggatcactcagtaacattctcaatcctaaaactgttttggtgtatgttacaatcatg
ccccaatttatcaatttgaacggaaatataaaccagcagctcatcattttagcttcaatc
ctaaccttattagcggtgttgtggttcctgtttcttgtttatattattgattacgcaaaa
aaatggatgaaaaactcgaagttccagaaagtgtttcaaaaaattaccggaataatatta
gtaggtttcggcatcaaaactggtttgagttaa

DBGET integrated database retrieval system