KEGG   Bacillus subtilis subsp. subtilis 168: BSU27100Help
Entry
BSU27100          CDS       T00010                                 

Gene name
yrhP
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysE Claudin_2 TerC DUF485 Kinocilin
Motif
Other DBs
NCBI-GeneID: 937592
NCBI-ProteinID: NP_390588
Pasteur: BG12304
BSORF: BG12304
UniProt: O05406
Position
complement(2768042..2768674)
Genome map
AA seq 210 aa AA seqDB search
MHSLLAYIPIAAMMVIIPGADTMLVMKNTLRYGPKAGRYNILGLATGLSFWTVIAILGLS
VVIAKSVILFTTIKYLGAAYLIYLGVKSFFAKSMFSLDDMQSQAKNMASSPKRYYKTSFM
QGSLSNILNPKTVLVYVTIMPQFINLNGNINQQLIILASILTLLAVLWFLFLVYIIDYAK
KWMKNSKFQKVFQKITGIILVGFGIKTGLS
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgcacagcttactcgcatacataccgatcgctgccatgatggttatcataccgggggca
gatacgatgcttgtgatgaaaaatacgcttaggtatggtccgaaagccggccgttataac
attctcggattggcgacaggactttccttttggacggtgattgccattttaggattatca
gtggtaatcgcaaagtcagtgattcttttcacaacgatcaaatatttgggagcggcatac
ttaatttatttaggtgtaaaaagtttttttgctaaaagtatgttttcgttagatgacatg
caatcccaagcaaaaaatatggcaagttctccgaaacgttattataaaacttcctttatg
cagggatcactcagtaacattctcaatcctaaaactgttttggtgtatgttacaatcatg
ccccaatttatcaatttgaacggaaatataaaccagcagctcatcattttagcttcaatc
ctaaccttattagcggtgttgtggttcctgtttcttgtttatattattgattacgcaaaa
aaatggatgaaaaactcgaagttccagaaagtgtttcaaaaaattaccggaataatatta
gtaggtttcggcatcaaaactggtttgagttaa

DBGET integrated database retrieval system