KEGG   Bacillus subtilis subsp. subtilis 168: BSU27110
Entry
BSU27110          CDS       T00010                                 

Gene name
yrhO
Definition
(RefSeq) hypothetical protein
  KO
K23356  HTH-type transcriptional regulator, sugar sensing transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU27110 (yrhO)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    BSU27110 (yrhO)
SSDB
Motif
Pfam: TrmB Regulator_TrmB DUF4363 TBCA HTH_IclR
Other DBs
NCBI-GeneID: 937224
NCBI-ProteinID: NP_390589
Pasteur: BG12303
BSORF: BG12303
UniProt: O05405 A0A6M4JLX8
Position
2768827..2769654
AA seq 275 aa
MKENMLDILKNLNFTEYESKAYLALLQESPLTGYAVAKKSGVPRSKIYEVLESLVIRGDV
FVSHGNTPQYVPVPAKELIKNRRLKAEEHFDQAEKYFEKFEQTANDRENIWNITGRSEIL
EKVKACILSAKKRILLEIWKEDFKEIEAELKQAAEQGVIVTIIAYGDIVSDFANVYLHDM
SSEITEEYDGRWLVYSGDDSEVVAGIVSLGNDSRAAWTMHVGLVMPITEVIIHDLYLMEI
LKKHRELLEESFGKNLIQLRRKFSIHSDFKKHYLE
NT seq 828 nt   +upstreamnt  +downstreamnt
atgaaagaaaatatgttagacattttaaaaaacctcaattttacagaatatgaatcgaaa
gcgtatttagcattattgcaagaatcacctttaacaggctatgccgttgccaaaaaatcc
ggagtgccccgttctaaaatttatgaagtattggaaagtcttgtcataaggggagatgtt
tttgtcagtcatggaaatacgcctcagtatgttccagtccccgcaaaagaactgattaaa
aaccgccggctcaaagcggaagagcattttgatcaggctgagaaatattttgaaaagttc
gagcagaccgcaaatgaccgggaaaacatctggaatatcaccggccgcagtgaaattctt
gaaaaggtgaaggcttgtatcttatctgccaaaaaaagaatcctcttagaaatatggaaa
gaggattttaaggagatagaagcagagctcaaacaggcggcagaacaaggcgttattgtc
accattattgcgtacggagacatcgtatctgattttgccaatgtttaccttcatgatatg
agcagtgaaattacagaagagtatgacggacggtggcttgtctatagcggagatgattca
gaagtagtagcgggcattgtctcacttggcaacgacagccgtgctgcatggacgatgcat
gtagggttagtcatgcctattactgaagtgatcattcatgatctgtacctcatggaaatt
ctgaaaaagcatagagagcttttagaagagagcttcgggaaaaatctcatccagttgcgc
cgtaaattttctattcactcagatttcaaaaaacattatttggaataa

DBGET integrated database retrieval system