KEGG   Bacillus subtilis subsp. subtilis 168: BSU27120
Entry
BSU27120          CDS       T00010                                 

Symbol
sigV
Name
(RefSeq) RNA polymerase sigma factor SigV
  KO
K03088  RNA polymerase sigma-70 factor, ECF subfamily
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsu03021]
    BSU27120 (sigV)
Transcription machinery [BR:bsu03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     BSU27120 (sigV)
SSDB
Motif
Pfam: Sigma70_r4_2 Sigma70_r2 Sigma70_r4 DUF4835 Sigma70_ECF
Other DBs
NCBI-GeneID: 937591
NCBI-ProteinID: NP_390590
Pasteur: BG11974
BSORF: BG11974
UniProt: O05404 A0A6M4JLD6
Position
2769850..2770350
AA seq 166 aa
MKKKQTTKALLVTCITDHKQDFYRLAFSYVKNQDDALDIVQESIKKALSSVETVRNPETI
KSWFYKILVRTAIDFLRKQKKIRVMDDETIEFLSKGKEDHYKDTDLHEALDELPYRYKTI
IILRFFEDLKLEEIAEITGENTNTVKTRLYRALKLMRIQLTKEDLS
NT seq 501 nt   +upstreamnt  +downstreamnt
atgaagaaaaaacaaacaacaaaagcgttgcttgtcacatgcataactgaccataagcaa
gatttctacaggttggctttcagttatgtgaaaaatcaagatgacgcattagatattgtt
caggaatctataaaaaaagcgctgagctcagttgaaacggtcaggaaccctgagacgata
aaaagctggttttataaaattttagtacggacagccattgactttttgcgcaaacaaaaa
aagataagagtgatggacgacgaaacgatagaatttttaagcaaaggaaaggaagaccat
tacaaggatactgatctccatgaagcgcttgacgaattgccgtaccgctataaaaccatt
attattttacgtttttttgaagacctcaaattagaagaaattgcggaaattacaggagaa
aacacgaataccgtcaaaacgcgcctatacagagcattgaagctgatgcgcattcagttg
acgaaggaggatctttcttaa

DBGET integrated database retrieval system