KEGG   Bacillus subtilis subsp. subtilis 168: BSU27130Help
Entry
BSU27130          CDS       T00010                                 

Gene name
rsiV
Definition
(RefSeq) anti-sigma-V factor RsiV
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3298 PdaC DUF4179 DUF835 Dicistro_VP4 Phage_Arf Toprim_2 CENP-W
Motif
Other DBs
NCBI-GeneID: 937593
NCBI-ProteinID: NP_390591
Pasteur: BG12302
BSORF: BG12302
UniProt: O05403
Structure
PDB: 

Position
2770350..2771207
Genome map
AA seq 285 aa AA seqDB search
MDKRLQQLREEYKNVQIPKELDIIVEKALQQEPKKKRIVMWPTSAAIAAAILFTALVNIN
PDAAQAMSKIPVIGKIVKAITFIEIKEEKDQSSIDVKTPALSGLSNKELENSINEKYLKE
SQQLYKEFIQSTSKNKKGHLSIYSDYETVTDTPDLLSIRRNIETTQASSYTQSRYITIDK
KNDILLTLKSLFKDERYIKVISQNIKEQMKQQMKEDPNKIYWLTDEDAEPFKTILPDQTF
YITEDHKLVISFDEYEVAPGYMGVTEFTIPTGVISNLLVGERYIR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggataagagattacagcaattaagagaagaatataaaaatgttcagattcctaaagaa
ttggatatcattgttgaaaaagcccttcagcaagaaccaaaaaagaaaagaatcgttatg
tggccgacatcagcagcaatcgctgcagctattttattcactgcgcttgttaatatcaac
ccggacgccgctcaggctatgtcaaagatccctgtcatcggcaaaatcgtcaaagcgatc
acctttattgaaatcaaagaggaaaaagaccaatcaagcattgatgtcaaaacacctgct
ttgtccgggctttctaataaagagcttgaaaacagcattaacgagaaatacttgaaagaa
agccagcagctgtataaagagtttatacagtccacatccaaaaacaaaaaagggcatctc
agcatctacagtgattacgagacggtcacagacacgccagatttactctctatccggcgc
aatattgaaacaacacaagcatcttcctacacacaaagccgttatattacaattgacaaa
aagaatgatattttacttacattaaaaagcttattcaaagatgagcgctatatcaaagtc
atcagtcaaaacatcaaagaacaaatgaaacagcaaatgaaggaagatccaaataaaata
tattggctcactgacgaagatgcagaaccgttcaaaacgattcttcctgatcagacgttt
tacattactgaagaccataaacttgtgatctcatttgacgaatatgaagtcgcccccggc
tatatgggcgttacagagtttacaattccaaccggcgtcatttcaaacttgctcgtggga
gaacgttatattcgataa

DBGET integrated database retrieval system