KEGG   Bacillus subtilis subsp. subtilis 168: BSU27140
Entry
BSU27140          CDS       T00010                                 

Symbol
oatA
Name
(RefSeq) peptidoglycan O-acetyltransferase YrhL
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Acyl_transf_3 Lipase_GDSL_2 Presenilin Zip DisA-linker UPF0688
Other DBs
NCBI-GeneID: 936583
NCBI-ProteinID: NP_390592
Pasteur: BG12301
BSORF: BG12301
UniProt: O05402 A0A6M3ZEU3
Position
2771318..2773222
AA seq 634 aa
MYHKTQHHRYIPGLDGLRAFAVLSVITYHLNFNWANGGFIGVDIFFVLSGYLITSILLPA
YGNDINLDFRDFWVRRIRRLLPAAYLMIFSTVVWVVLFDRELLHTVRGDAISSLFYMSNW
WFIFHKLSYFDSFGSPSPLKNLWSLAIEEQFYIIWPMFLVVGMYIMKSRARLAAVISLLV
LCSAVMMSVLYEPGGDPSRVYYGTDTRSFELLIGCALALVWPMKRLSSNRLPSKLKHTLH
ATEFLAFCILVLCVYFTDEYEPFLYRGGMLFISVTAAILIACVCHPSSFLGNLLSWRPLR
WLGTRSYGIYLWHYPVIVLSTPVQEIGNPVFWHIVLKVIVTCILAELSYHFIEKPIRTQG
FRSFSRRVFIHRIKEWKTTSVISKMSIGFIIFAILIFAGGLSGLAGEQKHPTKWTYSSQE
TNADTSQASGDKKNAAADKKHNPEQKTTDSNQGQKENKDSGQETHKKKDTQSQQLKKPAD
TAKEVLAIGDSVMLDISSHLRQSFSNVTIDGKVGRQMSQALELAREYKSFNQPNKAVIIE
LGTNGYFTNSQIEQLLQSFSKAHIYLVNTRVPRQWESKVNESLQQQAHAHQNVTLVDWHT
EALQHPEYFTPDGVHLVPKGAKTLTALIVQAMKS
NT seq 1905 nt   +upstreamnt  +downstreamnt
atgtatcacaagacacagcatcatcgatacattcctggacttgatggccttcgggctttc
gccgtcctgtcagttatcacttatcacctaaatttcaattgggctaacggtggttttatc
ggggttgatatcttttttgttttatccggatatttgattacatctattctattaccggca
tatggaaatgatatcaatcttgattttcgggatttttgggtgcgccgcattcggcggctt
ctcccggcagcgtaccttatgatcttttccactgttgtgtgggtcgtattgtttgatcga
gaactattgcacactgtacgtggagatgcgatctcttctctcttttatatgagcaattgg
tggtttatttttcacaagctatcatattttgatagtttcggttccccatcacctctaaaa
aacctttggtcgctggcgattgaagaacaattttatatcatatggccgatgtttttagtt
gttggaatgtacataatgaaaagccgcgccagattggctgcggtgatatcattgcttgtg
ctttgttcagccgtgatgatgagcgtactgtatgaacctggcggagatccgagccgcgtt
tactatggcacagacactcgttcgtttgaacttctcatcggatgtgccttggctttggta
tggccgatgaaaaggctgtcttccaacaggctgccaagcaaactgaagcacactttgcac
gccactgaatttttggcattttgtattttagtgttgtgtgtctatttcacagatgaatac
gagccttttctttacagaggcggaatgctattcattagcgtgactgccgcaatccttatt
gcatgtgtttgccatccgagcagctttttaggcaatctgctttcatggaggccgcttcgg
tggcttggaacgaggtcttacggaatttatctttggcactaccctgttattgtgttaagc
acgccagttcaagaaatcggaaaccctgttttttggcatatcgtgctaaaggtcattgtg
acatgtatacttgccgagctctcctaccattttattgagaagccgatacggacacaggga
tttaggtcattttcccgccgtgtttttatacatagaatcaaggaatggaaaacgacatct
gtcatcagcaaaatgtcaattggtttcattattttcgctatacttatttttgcaggcggg
ctgtcagggctagccggcgagcaaaagcaccctaccaaatggacctatagctcacaagaa
acaaatgctgacaccagccaggcttctggggataaaaagaacgctgcagcagataaaaaa
cacaatcctgaacaaaagacaacagattccaatcagggtcaaaaggaaaacaaagatagt
gggcaagagactcataaaaagaaagacacgcaatcccaacagttgaaaaaaccagcagac
actgcgaaagaagttttagctataggagattccgtcatgcttgatatttcttcacacctg
cgtcagtcattttcaaatgtgacgattgatggaaaggtagggagacaaatgtctcaagct
ttggaactcgcaagggaatacaagtcttttaatcagccgaacaaggctgtcatcattgag
cttggaaccaatggctattttacaaacagccaaatcgaacaactgcttcaatctttctca
aaagctcatatttatcttgtcaatacacgggttccccgccaatgggaaagcaaggtaaat
gaatctttgcagcaacaggcccacgcacatcaaaatgttacgttagttgactggcataca
gaagctcttcagcatccggaatattttacccctgatggtgttcacttggttcctaaaggg
gcaaaaactttgactgctcttattgttcaggcgatgaaatcgtaa

DBGET integrated database retrieval system