KEGG   Bacillus subtilis subsp. subtilis 168: BSU27140Help
Entry
BSU27140          CDS       T00010                                 

Gene name
oatA
Definition
(RefSeq) peptidoglycan O-acetyltransferase YrhL
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl_transf_3 Lipase_GDSL_2 Presenilin FUSC_2 DisA-linker Zip CPSF100_C UPF0688
Motif
Other DBs
NCBI-GeneID: 936583
NCBI-ProteinID: NP_390592
Pasteur: BG12301
BSORF: BG12301
UniProt: O05402
Position
2771318..2773222
Genome map
AA seq 634 aa AA seqDB search
MYHKTQHHRYIPGLDGLRAFAVLSVITYHLNFNWANGGFIGVDIFFVLSGYLITSILLPA
YGNDINLDFRDFWVRRIRRLLPAAYLMIFSTVVWVVLFDRELLHTVRGDAISSLFYMSNW
WFIFHKLSYFDSFGSPSPLKNLWSLAIEEQFYIIWPMFLVVGMYIMKSRARLAAVISLLV
LCSAVMMSVLYEPGGDPSRVYYGTDTRSFELLIGCALALVWPMKRLSSNRLPSKLKHTLH
ATEFLAFCILVLCVYFTDEYEPFLYRGGMLFISVTAAILIACVCHPSSFLGNLLSWRPLR
WLGTRSYGIYLWHYPVIVLSTPVQEIGNPVFWHIVLKVIVTCILAELSYHFIEKPIRTQG
FRSFSRRVFIHRIKEWKTTSVISKMSIGFIIFAILIFAGGLSGLAGEQKHPTKWTYSSQE
TNADTSQASGDKKNAAADKKHNPEQKTTDSNQGQKENKDSGQETHKKKDTQSQQLKKPAD
TAKEVLAIGDSVMLDISSHLRQSFSNVTIDGKVGRQMSQALELAREYKSFNQPNKAVIIE
LGTNGYFTNSQIEQLLQSFSKAHIYLVNTRVPRQWESKVNESLQQQAHAHQNVTLVDWHT
EALQHPEYFTPDGVHLVPKGAKTLTALIVQAMKS
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgtatcacaagacacagcatcatcgatacattcctggacttgatggccttcgggctttc
gccgtcctgtcagttatcacttatcacctaaatttcaattgggctaacggtggttttatc
ggggttgatatcttttttgttttatccggatatttgattacatctattctattaccggca
tatggaaatgatatcaatcttgattttcgggatttttgggtgcgccgcattcggcggctt
ctcccggcagcgtaccttatgatcttttccactgttgtgtgggtcgtattgtttgatcga
gaactattgcacactgtacgtggagatgcgatctcttctctcttttatatgagcaattgg
tggtttatttttcacaagctatcatattttgatagtttcggttccccatcacctctaaaa
aacctttggtcgctggcgattgaagaacaattttatatcatatggccgatgtttttagtt
gttggaatgtacataatgaaaagccgcgccagattggctgcggtgatatcattgcttgtg
ctttgttcagccgtgatgatgagcgtactgtatgaacctggcggagatccgagccgcgtt
tactatggcacagacactcgttcgtttgaacttctcatcggatgtgccttggctttggta
tggccgatgaaaaggctgtcttccaacaggctgccaagcaaactgaagcacactttgcac
gccactgaatttttggcattttgtattttagtgttgtgtgtctatttcacagatgaatac
gagccttttctttacagaggcggaatgctattcattagcgtgactgccgcaatccttatt
gcatgtgtttgccatccgagcagctttttaggcaatctgctttcatggaggccgcttcgg
tggcttggaacgaggtcttacggaatttatctttggcactaccctgttattgtgttaagc
acgccagttcaagaaatcggaaaccctgttttttggcatatcgtgctaaaggtcattgtg
acatgtatacttgccgagctctcctaccattttattgagaagccgatacggacacaggga
tttaggtcattttcccgccgtgtttttatacatagaatcaaggaatggaaaacgacatct
gtcatcagcaaaatgtcaattggtttcattattttcgctatacttatttttgcaggcggg
ctgtcagggctagccggcgagcaaaagcaccctaccaaatggacctatagctcacaagaa
acaaatgctgacaccagccaggcttctggggataaaaagaacgctgcagcagataaaaaa
cacaatcctgaacaaaagacaacagattccaatcagggtcaaaaggaaaacaaagatagt
gggcaagagactcataaaaagaaagacacgcaatcccaacagttgaaaaaaccagcagac
actgcgaaagaagttttagctataggagattccgtcatgcttgatatttcttcacacctg
cgtcagtcattttcaaatgtgacgattgatggaaaggtagggagacaaatgtctcaagct
ttggaactcgcaagggaatacaagtcttttaatcagccgaacaaggctgtcatcattgag
cttggaaccaatggctattttacaaacagccaaatcgaacaactgcttcaatctttctca
aaagctcatatttatcttgtcaatacacgggttccccgccaatgggaaagcaaggtaaat
gaatctttgcagcaacaggcccacgcacatcaaaatgttacgttagttgactggcataca
gaagctcttcagcatccggaatattttacccctgatggtgttcacttggttcctaaaggg
gcaaaaactttgactgctcttattgttcaggcgatgaaatcgtaa

DBGET integrated database retrieval system