KEGG   Bacillus subtilis subsp. subtilis 168: BSU27150Help
Entry
BSU27150          CDS       T00010                                 

Gene name
yrhK
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YrhK TerC DUF334
Motif
Other DBs
NCBI-GeneID: 937587
NCBI-ProteinID: NP_390593
Pasteur: BG12300
BSORF: BG12300
UniProt: O05401
Position
2773356..2773646
Genome map
AA seq 96 aa AA seqDB search
MKGNEEHDIQKELKRYELFFKKRYKVLYTVNDFIIGAMFLVGSFFFFYDRLMSAGIWLFA
IGSLLLLIRPTIRLIHDFHYRKHVEQQFKHQSSTDD
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaaatgaagaacatgacatccaaaaagagttgaaacgatatgagctttttttc
aaaaaacgatataaggttctttatacagtaaacgattttatcatcggtgctatgtttctc
gttggaagttttttctttttttatgaccggttaatgtcggcagggatatggctgtttgcg
atcggaagtttgctgctgttaatcaggccgaccattcggctgattcatgactttcattac
cgtaagcatgtggaacagcaattcaagcatcaatcttcaacagatgactga

DBGET integrated database retrieval system