KEGG   Bacillus subtilis subsp. subtilis 168: BSU27150
Entry
BSU27150          CDS       T00010                                 

Symbol
yrhK
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YrhK
Other DBs
NCBI-GeneID: 937587
NCBI-ProteinID: NP_390593
Pasteur: BG12300
BSORF: BG12300
UniProt: O05401 A0A6M4JNT6
Position
2773356..2773646
AA seq 96 aa
MKGNEEHDIQKELKRYELFFKKRYKVLYTVNDFIIGAMFLVGSFFFFYDRLMSAGIWLFA
IGSLLLLIRPTIRLIHDFHYRKHVEQQFKHQSSTDD
NT seq 291 nt   +upstreamnt  +downstreamnt
atgaaaggaaatgaagaacatgacatccaaaaagagttgaaacgatatgagctttttttc
aaaaaacgatataaggttctttatacagtaaacgattttatcatcggtgctatgtttctc
gttggaagttttttctttttttatgaccggttaatgtcggcagggatatggctgtttgcg
atcggaagtttgctgctgttaatcaggccgaccattcggctgattcatgactttcattac
cgtaagcatgtggaacagcaattcaagcatcaatcttcaacagatgactga

DBGET integrated database retrieval system