KEGG   Bacillus subtilis subsp. subtilis 168: BSU27160
Entry
BSU27160          CDS       T00010                                 

Symbol
cypB
Name
(RefSeq) bifunctional P-450/NADPH-P450 reductase 2
  KO
K14338  cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00071  Fatty acid degradation
bsu00380  Tryptophan metabolism
bsu00627  Aminobenzoate degradation
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSU27160 (cypB)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    BSU27160 (cypB)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BSU27160 (cypB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bsu00199]
    BSU27160 (cypB)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     BSU27160 (cypB)
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     BSU27160 (cypB)
Cytochrome P450 [BR:bsu00199]
 Cytochrome P450, fungi type
  CYP505 family
   BSU27160 (cypB)
 Cytochrome P450, bacteria type
  CYP102 family
   BSU27160 (cypB)
SSDB
Motif
Pfam: p450 FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 937585
NCBI-ProteinID: NP_390594
Pasteur: BG12299
BSORF: BG12299
UniProt: O08336 A0A6M3ZEC0
Position
complement(2773890..2777054)
AA seq 1054 aa
MKQASAIPQPKTYGPLKNLPHLEKEQLSQSLWRIADELGPIFRFDFPGVSSVFVSGHNLV
AEVCDEKRFDKNLGKGLQKVREFGGDGLFTSWTHEPNWQKAHRILLPSFSQKAMKGYHSM
MLDIATQLIQKWSRLNPNEEIDVADDMTRLTLDTIGLCGFNYRFNSFYRDSQHPFITSML
RALKEAMNQSKRLGLQDKMMVKTKLQFQKDIEVMNSLVDRMIAERKANPDENIKDLLSLM
LYAKDPVTGETLDDENIRYQIITFLIAGHETTSGLLSFAIYCLLTHPEKLKKAQEEADRV
LTDDTPEYKQIQQLKYIRMVLNETLRLYPTAPAFSLYAKEDTVLGGEYPISKGQPVTVLI
PKLHRDQNAWGPDAEDFRPERFEDPSSIPHHAYKPFGNGQRACIGMQFALQEATMVLGLV
LKHFELINHTGYELKIKEALTIKPDDFKITVKPRKTAAINVQRKEQADIKAETKPKETKP
KHGTPLLVLFGSNLGTAEGIAGELAAQGRQMGFTAETAPLDDYIGKLPEEGAVVIVTASY
NGAPPDNAAGFVEWLKELEEGQLKGVSYAVFGCGNRSWASTYQRIPRLIDDMMKAKGASR
LTAIGEGDAADDFESHRESWENRFWKETMDAFDINEIAQKEDRPSLSITFLSEATETPVA
KAYGAFEGIVLENRELQTAASTRSTRHIELEIPAGKTYKEGDHIGILPKNSRELVQRVLS
RFGLQSNHVIKVSGSAHMAHLPMDRPIKVVDLLSSYVELQEPASRLQLRELASYTVCPPH
QKELEQLVSDDGIYKEQVLAKRLTMLDFLEDYPACEMPFERFLALLPSLKPRYYSISSSP
KVHANIVSMTVGVVKASAWSGRGEYRGVASNYLAELNTGDAAACFIRTPQSGFQMPNDPE
TPMIMVGPGTGIAPFRGFIQARSVLKKEGSTLGEALLYFGCRRPDHDDLYREELDQAEQD
GLVTIRRCYSRVENEPKGYVQHLLKQDTQKLMTLIEKGAHIYVCGDGSQMAPDVERTLRL
AYEAEKAASQEESAVWLQKLQDQRRYVKDVWTGM
NT seq 3165 nt   +upstreamnt  +downstreamnt
atgaaacaggcaagcgcaatacctcagcccaaaacatacggacctttaaaaaatcttccg
catctggaaaaagaacagctttctcaatccttatggcggatagctgatgaattgggaccg
attttccgttttgattttccgggagtatccagtgtttttgtgtccggccacaatcttgtg
gctgaagtgtgtgatgaaaaacgctttgacaagaaccttggcaaaggcttgcaaaaggtg
cgtgagttcgggggagatggcttatttacaagctggacgcacgaaccgaactggcaaaaa
gcccaccgcattttgctgccgagttttagtcaaaaagcgatgaaaggctatcattctatg
atgctggatatcgcaacccagctgattcaaaagtggagccggttaaaccctaatgaagaa
attgatgtagcggacgatatgacacgtctgacgcttgatacgattgggttatgcgggttt
aactatcgattcaacagcttttaccgtgattcacagcatccgtttatcaccagtatgctc
cgtgccttaaaagaggcgatgaatcaatcgaaaagactgggcctgcaagataaaatgatg
gtgaaaacgaagctgcagttccaaaaggatatagaagtcatgaactccctggttgataga
atgatagcggagcgaaaggcgaatccggatgaaaacattaaggatctcttgtctctcatg
ctttatgccaaagatccagtaacgggtgaaacgctggatgacgaaaacattcgataccaa
atcatcacatttttaattgctggacatgagacaacaagcgggttgctatcctttgcgatt
tattgtctgcttacacatccggaaaaactgaaaaaagctcaggaggaagcggatcgcgtg
ttaacggatgacacgcctgaatataaacaaatccagcagctcaaatacattcggatggtt
ttaaatgaaaccctcagactgtatccaacagctccggctttttctctatatgcgaaggag
gatactgttctaggcggggaatatccgatcagcaaagggcagccagtcactgttttaatt
ccaaaactgcaccgggatcaaaacgcttggggaccggatgcggaagatttccgtccggaa
cggtttgaggatccttcaagtatccctcaccatgcgtataagccgtttggaaacggacag
cgcgcttgtattggcatgcagtttgctcttcaagaagcgacaatggttctcggtcttgta
ttaaagcattttgaattgataaaccatactggctacgaactaaaaatcaaagaagcatta
acgatcaagccggatgattttaaaattactgtgaaaccgcgaaaaacagcggcaatcaat
gtacagagaaaagaacaggcagacatcaaagcagaaacaaagccaaaagaaaccaaacct
aaacacggcacacctttacttgttctttttggttcaaatcttgggacagctgagggaata
gccggtgaactggctgctcaaggccgccagatgggctttacagctgaaacggctccgctt
gatgattatatcggcaagctccctgaagaaggggcagtcgtcattgtaacggcttcttat
aatggggcgccgcctgataatgctgccggatttgtagagtggctgaaagagcttgaggaa
ggccaattgaaaggtgtttcctatgcggtattcggctgcggaaaccggagctgggccagc
acgtatcagcggattccccgcctgattgatgacatgatgaaagcaaagggggcatcgcgt
ttaacagcgattggggaaggtgacgccgccgatgattttgaaagccaccgcgagtcttgg
gaaaaccgcttctggaaggaaacgatggacgcatttgatattaacgaaatagcccagaaa
gaagacaggccttcattatcgattacttttctcagtgaagcgacggaaacgccggttgct
aaagcatatggcgcgtttgaagggattgtgttagagaatcgagaactccagacagctgcc
agcacgcgttcaacccgccatattgaattggaaattccggctggtaaaacatataaagaa
ggcgatcatatcggaatcctgccaaagaacagcagggagcttgttcagcgggttctcagc
cgattcggtttgcagtccaatcatgtgataaaagtaagcggaagcgctcatatggctcat
ctgccgatggatcggccaatcaaagtagtggatttattgtcgtcctatgtagagctgcag
gaaccggcatcaaggcttcagcttcgggagctggcctcttatacagtttgtccgccgcat
caaaaagagctggaacagctcgtttcagatgatggcatttacaaagagcaggtacttgca
aaacgtcttaccatgcttgattttttagaggattatcctgcttgcgaaatgccgtttgaa
cggtttttagcacttttgccatcactaaaaccgagatactattccatttcaagctcaccg
aaagttcatgcaaatatcgtgagcatgacggtaggagttgtgaaagcctcagcatggagc
ggccgaggtgaataccggggtgtcgcctctaattatttagcagaattgaatacaggtgat
gcagcagcttgcttcattcgtacgccgcagtccggatttcagatgccgaatgatcctgaa
acgcctatgattatggtcgggccgggcacaggaattgcgccattcagaggctttattcag
gcaagatcggttttgaagaaggaaggaagcacccttggtgaagcacttttatacttcggc
tgccgccgcccggaccatgacgacctttacagagaagagctggatcaagcggaacaggac
ggtttggtcacaatccgccgatgctactcgcgcgtcgaaaacgaaccaaaaggatatgtc
cagcacttgctcaagcaagatacgcagaaattgatgacactcattgaaaaaggggctcat
atttacgtatgcggtgatggatcgcaaatggctcctgatgtagagagaactttgcgattg
gcatatgaagctgaaaaagcagcaagtcaggaagaatcagctgtatggctgcaaaagctg
caagatcaaagacgttatgtgaaagacgtttggacaggaatgtaa

DBGET integrated database retrieval system