KEGG   Bacillus subtilis subsp. subtilis 168: BSU27170
Entry
BSU27170          CDS       T00010                                 

Gene name
bscR
Definition
(RefSeq) TetR family transcriptional regulator
  KO
K22106  TetR/AcrR family transcriptional regulator, repressor of fatR-cypB operon
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU27170 (bscR)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   TetR/AcrR family
    BSU27170 (bscR)
SSDB
Motif
Pfam: TetR_C_10 TetR_N TetR_C_29 SiaC
Other DBs
NCBI-GeneID: 938491
NCBI-ProteinID: NP_390595
Pasteur: BG12298
BSORF: BG12298
UniProt: O08335 A0A6M4JRK6
Position
complement(2777070..2777654)
AA seq 194 aa
MISASSSKYDMIMKASVSLFTERGFDATTIPMIAERAHVGTGTIYRYFDSKETLVNVLFQ
ESIQRFTEKLKQDVSELPVREGFHHVFCCLVQFTKESDYALFFLETKKDAHYLNHTSKKM
IENLTQMLDDYFNKGKAEGVIRSLPSNVLIAIVLGAFLKIYQLVQTGDIEMDTDLITELE
QCCWDAIKLHSSQK
NT seq 585 nt   +upstreamnt  +downstreamnt
atgatatccgcatccagcagtaaatacgacatgattatgaaagcgtcagtctcacttttt
acggaaaggggttttgacgctaccactattcctatgatagctgaacgtgctcatgtaggg
acaggaacgatctatcgttattttgacagcaaagaaacactcgttaacgtactgtttcaa
gaaagcatccagcgatttacggaaaaactgaagcaagacgtttcagaattgcctgtcaga
gaaggctttcaccacgtattttgctgtctcgttcagtttacgaaagagagcgactatgcg
cttttttttcttgaaaccaaaaaagacgctcattacttaaatcatacaagcaaaaaaatg
atagaaaatctgactcaaatgcttgatgactattttaataagggaaaagcggaaggcgtg
attcgcagcctgccctctaatgtgttaattgcgattgtattaggggcgtttctcaagata
tatcagctcgttcaaacaggtgatatagagatggacactgatttaattactgaattggaa
caatgctgctgggacgccattaagcttcattcatcacaaaaatag

DBGET integrated database retrieval system