KEGG   Bacillus subtilis subsp. subtilis 168: BSU27180
Entry
BSU27180          CDS       T00010                                 

Symbol
yrhH
Name
(RefSeq) methyltransferase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Methyltransf_11 Methyltransf_25 Ubie_methyltran Methyltransf_12 Methyltransf_23 Methyltransf_31 RrnaAD MTS Methyltransf_8 Fibrillarin PCMT N6_N4_Mtase
Other DBs
NCBI-GeneID: 938507
NCBI-ProteinID: NP_390596
Pasteur: BG12297
BSORF: BG12297
UniProt: O05400 A0A6M3ZEF0
Position
complement(2777877..2778419)
AA seq 180 aa
MLENRLYKRSDFWKLFSRKYKLTKTIEHMMIDSIDIQENDRILEIGIGNGTVFKSITKKL
KKGSLKSIDPSKRKVRQISRANRKNMGNGEVFHGYPEDIPFDDRTFNKVFSLHTVQSCTD
IRLALREIYRVLQIDGRFYISIDTNTGEKEKTYIQLLKDQHFRDLSVIRRASCLCIVAVK
NT seq 543 nt   +upstreamnt  +downstreamnt
atgctagaaaatagactctataaacgatcggatttttggaaattattttctcggaaatat
aagctaaccaaaacaattgagcatatgatgattgactctatagatatacaagaaaatgac
agaattttagaaattggaattggaaacggcactgtctttaaaagcataaccaagaaacta
aaaaagggtagcctaaaaagcattgatccttcaaaacgaaaggtaagacagatatcacgt
gcgaatcgaaagaacatggggaacggggaggtttttcatggctatccagaggacattccc
tttgatgaccgtacctttaataaagtcttttctttacatacggttcaaagctgcaccgat
attaggcttgcattaagagaaatttacagggtgcttcaaattgacggccggttttatatc
agtattgacacaaataccggtgaaaaagagaaaacgtatattcaactgctgaaagaccag
catttcagggatctttctgttatcaggcgtgcttcctgtctatgtattgtggctgttaaa
taa

DBGET integrated database retrieval system