KEGG   Bacillus subtilis subsp. subtilis 168: BSU27180Help
Entry
BSU27180          CDS       T00010                                 

Gene name
yrhH
Definition
(RefSeq) methyltransferase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Ubie_methyltran Methyltransf_31 Methyltransf_12 Methyltransf_23 RrnaAD MTS Methyltransf_8 Fibrillarin PCMT N6_N4_Mtase MetW
Motif
Other DBs
NCBI-GeneID: 938507
NCBI-ProteinID: NP_390596
Pasteur: BG12297
BSORF: BG12297
UniProt: O05400
Position
complement(2777877..2778419)
Genome map
AA seq 180 aa AA seqDB search
MLENRLYKRSDFWKLFSRKYKLTKTIEHMMIDSIDIQENDRILEIGIGNGTVFKSITKKL
KKGSLKSIDPSKRKVRQISRANRKNMGNGEVFHGYPEDIPFDDRTFNKVFSLHTVQSCTD
IRLALREIYRVLQIDGRFYISIDTNTGEKEKTYIQLLKDQHFRDLSVIRRASCLCIVAVK
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgctagaaaatagactctataaacgatcggatttttggaaattattttctcggaaatat
aagctaaccaaaacaattgagcatatgatgattgactctatagatatacaagaaaatgac
agaattttagaaattggaattggaaacggcactgtctttaaaagcataaccaagaaacta
aaaaagggtagcctaaaaagcattgatccttcaaaacgaaaggtaagacagatatcacgt
gcgaatcgaaagaacatggggaacggggaggtttttcatggctatccagaggacattccc
tttgatgaccgtacctttaataaagtcttttctttacatacggttcaaagctgcaccgat
attaggcttgcattaagagaaatttacagggtgcttcaaattgacggccggttttatatc
agtattgacacaaataccggtgaaaaagagaaaacgtatattcaactgctgaaagaccag
catttcagggatctttctgttatcaggcgtgcttcctgtctatgtattgtggctgttaaa
taa

DBGET integrated database retrieval system