KEGG   Bacillus subtilis subsp. subtilis 168: BSU27190
Entry
BSU27190          CDS       T00010                                 

Symbol
yrzI
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Bac_small_YrzI
Other DBs
NCBI-GeneID: 937584
NCBI-ProteinID: NP_390597
Pasteur: BG13819
BSORF: BG13819
UniProt: O32027 A0A6M3ZHS6
Position
complement(2778923..2779072)
AA seq 49 aa
MTINLFFLTLTIKKRFKSLEEFEREQQIEQIYDEMKESQLKHLYLTNWR
NT seq 150 nt   +upstreamnt  +downstreamnt
atgacgattaacctattctttttaacgttaacgattaaaaaacggtttaaaagcctggaa
gaattcgaacgagaacagcagattgaacaaatttatgatgaaatgaaagagtctcagtta
aagcatctttatttaacaaactggcgctaa

DBGET integrated database retrieval system