KEGG   Bacillus subtilis subsp. subtilis 168: BSU27200Help
Entry
BSU27200          CDS       T00010                                 

Gene name
yrhG
Definition
(RefSeq) transporter
  KO
K21993  formate transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU27200 (yrhG)
Transporters [BR:bsu02000]
 Other Transporters
  Pores ion channels [TC:1]
   BSU27200 (yrhG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Form_Nir_trans Yip1
Motif
Other DBs
NCBI-GeneID: 937992
NCBI-ProteinID: NP_390598
Pasteur: BG12296
BSORF: BG12296
UniProt: O05399
Position
complement(2779462..2780262)
Genome map
AA seq 266 aa AA seqDB search
MAFRKPDEIAEAAIEAGMKKIKLPLPSLLVLGFLGGAFIALGYLLDIRVIGDLPKEWGSL
SSLIGAAVFPVGLILVVLAGAELITGNMMSVAMALFSRKISVKELAINWGIVTIMNLIGA
LFVAYFFGHLVGLTETGPYLEKTIAVAQGKLDMSFGKVLISAIGCNWLVCLAVWLSFGAQ
DAAGKILGIWFPIMAFVAIGFQHVVANMFVIPAAIFAGSFTWGQFIGNIIPAFIGNVIGG
AVFVGLIYFIAYHKKDRSRKEMKQVS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggcttttcgaaaaccggatgaaatagcggaagcagcaattgaagcagggatgaaaaaa
ataaagctcccgctgccgtcactgcttgtgctggggtttttaggcggtgcatttatcgcg
cttgggtatttgcttgatatcagggtaattggcgatcttccgaaagaatgggggagcctg
tccagtttgattggtgcagcagtatttccagtcggcctgatccttgtcgttctcgctggc
gctgaactgatcacaggcaatatgatgtcagttgcgatggcgttattttcgagaaaaata
tcagtaaaagagttagcgattaactggggaatcgtcacaattatgaacttaatcggcgca
ttgtttgttgcttactttttcgggcatttggttggattgactgaaacaggtccttattta
gaaaaaacgattgccgttgcccaaggaaagcttgatatgagctttggcaaggttctcatt
tccgccatcggctgtaactggcttgtatgtcttgcagtgtggctttctttcggcgcccaa
gacgcagcaggaaaaatccttggcatctggttcccaatcatggcttttgtggctatcgga
tttcagcacgttgtcgccaacatgtttgtgattcctgctgccatttttgcaggctcattc
acgtgggggcagttcatcggaaacatcattccggcttttatcggtaatgtcatcggcgga
gctgtatttgtcggtctcatttattttattgcatatcataagaaagaccgctccagaaaa
gaaatgaagcaggtgtcatga

DBGET integrated database retrieval system