KEGG   Bacillus subtilis subsp. subtilis 168: BSU27210
Entry
BSU27210          CDS       T00010                                 

Symbol
yrhF
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MpsC
Other DBs
NCBI-GeneID: 936371
NCBI-ProteinID: NP_390599
Pasteur: BG12295
BSORF: BG12295
UniProt: O05398 A0A6M3ZJJ3
Position
complement(2780525..2780893)
AA seq 122 aa
MSKKIHEFNDIIRKLRKELFGKGPERIHTVFVENMAVSTLYGNLSASEQFIARTPEGREM
VHAARTSLIQDLYSKQTPEGMEELMGAKLVHLFSDIKIEENIAVSVFVFDRKIDEQKEAL
QS
NT seq 369 nt   +upstreamnt  +downstreamnt
atgtctaaaaaaattcatgaattcaatgatattattcgaaaacttcgcaaagaattgttc
ggaaaagggcctgagagaattcatactgtatttgtagaaaacatggcagtttcaacacta
tacggaaatctgagtgcaagcgagcagtttattgcccgcacgcctgaaggaagagagatg
gtacatgcggcccggacaagcctaattcaagacctttattccaaacaaacaccggaagga
atggaggaacttatgggagctaagctagtccatttgttttctgatattaaaattgaggaa
aacatcgctgtatctgtatttgtttttgaccgaaaaatagatgagcaaaaagaagctctg
caaagctag

DBGET integrated database retrieval system