KEGG   Bacillus subtilis subsp. subtilis 168: BSU27210Help
Entry
BSU27210          CDS       T00010                                 

Gene name
yrhF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2294
Motif
Other DBs
NCBI-GeneID: 936371
NCBI-ProteinID: NP_390599
Pasteur: BG12295
BSORF: BG12295
UniProt: O05398
Position
complement(2780525..2780893)
Genome map
AA seq 122 aa AA seqDB search
MSKKIHEFNDIIRKLRKELFGKGPERIHTVFVENMAVSTLYGNLSASEQFIARTPEGREM
VHAARTSLIQDLYSKQTPEGMEELMGAKLVHLFSDIKIEENIAVSVFVFDRKIDEQKEAL
QS
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaaaaattcatgaattcaatgatattattcgaaaacttcgcaaagaattgttc
ggaaaagggcctgagagaattcatactgtatttgtagaaaacatggcagtttcaacacta
tacggaaatctgagtgcaagcgagcagtttattgcccgcacgcctgaaggaagagagatg
gtacatgcggcccggacaagcctaattcaagacctttattccaaacaaacaccggaagga
atggaggaacttatgggagctaagctagtccatttgttttctgatattaaaattgaggaa
aacatcgctgtatctgtatttgtttttgaccgaaaaatagatgagcaaaaagaagctctg
caaagctag

DBGET integrated database retrieval system