KEGG   Bacillus subtilis subsp. subtilis 168: BSU27220Help
Entry
BSU27220          CDS       T00010                                 

Gene name
yrhE
Definition
(RefSeq) formate dehydrogenase YrhE
  KO
K00123  formate dehydrogenase major subunit [EC:1.17.1.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00630  Glyoxylate and dicarboxylate metabolism
bsu00680  Methane metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BSU27220 (yrhE)
  09102 Energy metabolism
   00680 Methane metabolism
    BSU27220 (yrhE)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.9  formate dehydrogenase
     BSU27220 (yrhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Molybdopterin Molydop_binding Molybdop_Fe4S4 Fer2_4 NADH-G_4Fe-4S_3 Fer4 Fer4_6 Fer4_21 Fer4_7 Fer4_10 Fer4_9 Fer4_8 Fer4_2 Fer4_15 Fer4_18 Fer4_13 Fer4_16 Fer4_4
Motif
Other DBs
NCBI-GeneID: 937569
NCBI-ProteinID: NP_390600
Pasteur: BG12294
BSORF: BG12294
UniProt: Q795Y4
Position
2781209..2784151
Genome map
AA seq 980 aa AA seqDB search
MMDVKSISVRVDGTEIQARAGATILDILNENGIEYPQICHVPEVDPIQTCDTCIVEANGK
LVRSCATVAENGMSIDLSGNRVKEAQTEAMDRLLENHLLYCTVCDNNNGNCTLHNTAEMM
GIEHQKYPYTPKEDPSCAVDMSHPFYRYDPNQCIACGQCVEVCQNLQVNETLSIDWERER
PRVIWDEGVPINESSCVSCGQCVTVCPCNALMEKSMLGQAGFMTGIKEDVMEPMIDLVKN
VEPGYGSIFAISEVEAAMRETRTKKTKTVCTFCGVGCSFEVWTKGRDILKIQPVSDAPVN
AISTCVKGKFGWDFVNSKERITKPLIRKNGAFVESSWEEALDLVASRLGSIKEQYGKGSV
GFISSSKITNEENYVIQKLARQVFETNNVDNCSRYCQSPATDGLFRTVGMGGDAGTIKDI
AKAGLVIIVGANPAEGHPVLATRVKRAHKLHGQKLIVADLRKNEMAERSDLFISPKQGTD
QVWLMAVTKYMIDQGWHDQAFIDENVNYFEDYKETLKTYTLDYAERITGLSKENIIQIAE
MIRDADGTCVLWGMGVTQNTGGSDTSAAISNLLLATGNYRRPGAGAYPLRGHNNVQGACD
MGTLPGWLPGYQHITDDKARAKFEEAYGVEIDGKPGLDNIQMLHAIEEGKMKAMYLVGED
MALVDSNANHVHDILSSLDFFVVQDIFLSRTAQYADVVLPATPSLEKDGTFTNTERRVQR
LYQALPTLGDAKPDWWIIQEVANRLGANWNYSHPSDIFSEMASLSPLFAKASYEVLEGWN
SFLWGSFTGESTPLLYEDGFNFPDKKARFALSDWTEPAAFPEEYDLHINNGRMLEHFHEG
NMTNKSKGIQAKVPNVFVEISPELAQERGVCDGSLVRLVSPFGAVKLNALITDRVRKNEL
YLPMNSTDKESAINFLTGPAADKRTNTPAYKQTKVRMEVLGGCETAPLPKTNPRNKKRHP
QNGVEAERKWNRPGYVHLTD
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgttaagtcgatcagtgtccgtgtagacggaacagaaattcaagcacgagca
ggggccacaattttagatattttaaatgaaaacggaattgagtacccgcagatttgccac
gtaccagaggttgacccgattcaaacttgtgatacttgcatagtagaggcaaacggcaag
ctggttcgttcatgcgcgacggttgcagaaaacgggatgtctattgatctttcaggaaat
cgagtgaaagaagcgcaaaccgaagcgatggaccgccttcttgaaaatcatttgctgtat
tgtacagtttgcgataacaacaatggaaactgtacgctgcataatacagcggaaatgatg
gggatcgagcatcaaaaatacccatacacgccaaaagaagatccttcttgcgcggttgat
atgtctcatcctttttaccgctatgatccaaaccaatgtattgcctgcggccagtgtgtt
gaggtctgtcaaaaccttcaggtaaatgaaacactctcaatcgactgggaacgcgaacgc
cctcgcgtcatttgggatgagggagttccgatcaatgaatcttcctgtgtcagctgcggt
cagtgtgtaacagtatgtccatgtaatgcactgatggaaaaatcaatgctcgggcaggct
ggttttatgacaggcattaaagaggacgtcatggaaccgatgattgatctcgtgaaaaat
gttgaaccggggtatggcagcatttttgccatttctgaagtcgaagcggcaatgcgtgaa
acgagaacgaaaaaaacgaaaactgtatgtacgttctgcggtgtcggatgttcatttgaa
gtatggacaaaaggacgggatattttaaagatccagcctgtttctgatgctccggttaac
gcaatttccacatgtgtcaaagggaaattcggctgggattttgtcaattcaaaagagcgg
atcacaaagcctttaatccgtaaaaacggagcctttgtggaatcttcttgggaagaagcc
ctcgatcttgtcgcaagcagattaggatcaattaaagagcagtacggtaaaggctctgta
gggtttatttcttcttctaaaattacgaatgaagaaaactacgtcattcaaaaactagcg
cgtcaggtatttgaaacaaacaacgtcgataactgctcacgctactgccagtctcctgct
acagacggattgttccgcactgtcggcatgggcggtgacgccggcacgattaaagatatt
gccaaagcaggcctggtcatcattgtcggtgccaatccggcggaaggacacccagtgctc
gcaacacgcgtcaaacgggcacacaagctccacggtcaaaaactgattgttgctgacctg
cgtaaaaatgagatggctgagcgatctgatctgttcatcagccctaaacaaggcacagac
caagtttggctgatggctgttacgaaatatatgatcgaccaaggctggcacgatcaggcg
tttattgatgagaacgtcaattactttgaagattataaagaaacccttaaaacgtatacg
cttgattatgcagaacgcatcacaggcctttcaaaagaaaacatcattcaaattgctgaa
atgattcgtgatgctgacggcacttgtgtcctttggggaatgggtgtcacacaaaataca
ggcggttctgatacatcagcagccatttcaaacctgcttctcgctacgggcaactatcgc
cgtccaggtgccggcgcttatcctctgcgcggacacaataacgtgcaaggcgcatgtgat
atgggaacattgcctggctggctgccgggatatcagcatattacagatgacaaagcacgc
gctaaatttgaagaggcatatggtgtcgagattgatggaaagcctggtttagataatatt
caaatgcttcatgccattgaagaaggaaaaatgaaagctatgtatcttgtcggtgaggat
atggcactggtcgattcaaacgcgaaccatgtgcatgatattttatcaagccttgatttc
ttcgtggtacaggacatcttcctgtcaagaacagctcaatatgctgatgtcgtcttgccg
gccactccttcacttgaaaaagacggaacatttaccaacacagaacgccgtgtccagcga
ttgtatcaggcgcttccgacgcttggtgacgcaaaaccggactggtggattattcaagag
gtggcaaaccgtttaggagcgaattggaattacagccatccaagtgacattttctctgaa
atggcgagtctttctcctctgtttgccaaagcaagctatgaggtgcttgaaggctggaac
agcttcctatggggcagcttcacaggtgaaagcacaccgcttctgtatgaagacggattt
aatttccctgacaaaaaagcccgctttgccctttctgattggaccgagccagcggcattt
ccggaggaatatgaccttcatatcaataacggccggatgctggagcatttccacgaagga
aacatgacaaataaatcgaaaggcatccaagcgaaagtgccgaatgtattcgttgagatc
tcacctgagcttgcacaagagcgaggtgtttgtgacggttcgcttgtacggctcgtttct
ccgttcggagcagtcaaattgaacgcgctgatcacagaccgggtacggaaaaatgaactc
tatttgccaatgaactcgacagacaaggagtcagcgattaacttcttgacgggccctgca
gctgataaacggacgaacacgcctgcttataaacagacaaaggtccgcatggaagtgctt
ggcggctgtgaaacagcgccgcttccaaaaacaaatccgcgcaacaaaaaacggcatccg
caaaacggagtcgaagcagaaagaaaatggaaccgccctggctatgtacatctgactgat
taa

DBGET integrated database retrieval system