KEGG   Bacillus subtilis subsp. subtilis 168: BSU27230
Entry
BSU27230          CDS       T00010                                 

Symbol
yrhD
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1641 FliD_N
Other DBs
NCBI-GeneID: 937583
NCBI-ProteinID: NP_390601
Pasteur: BG12293
BSORF: BG12293
UniProt: O05396 A0A6M4JLE5
Position
2784170..2784652
AA seq 160 aa
MATPITTIKKETKTAEQIKLEKIEELKELLAENEDAVSKTMTLMNELNDLGIFDAATSML
RAKEDIAKIALGQVSREPVTNLINTMMAAGGALTKADPEFTAKLLESVMAGTEQAQSFLK
EDKKVGILDLLKAMNDPDINRAVGFGLQFLKGMGKELREQ
NT seq 483 nt   +upstreamnt  +downstreamnt
atggccactccgattacgacgatcaaaaaagaaacaaaaacagctgagcaaattaagctt
gaaaaaatagaagaactgaaagagctgctggcggaaaatgaggacgccgtctctaaaacg
atgacgttaatgaatgaactcaatgatcttggaatttttgatgcggcaacaagcatgctc
agagcgaaggaagacattgccaagattgcgcttggccaagtttcccgcgagcctgtcacc
aacctcatcaacacgatgatggccgccggaggcgcattgacaaaagccgatcctgagttt
acagcaaagcttttagaaagcgtaatggctgggactgaacaggcacaaagctttttaaaa
gaagacaagaaagtcgggattctcgacctgttaaaagcaatgaacgatcctgacatcaac
agagccgtcgggttcggccttcagtttttaaaaggcatgggaaaagaacttcgagaacaa
taa

DBGET integrated database retrieval system