KEGG   Bacillus subtilis subsp. subtilis 168: BSU27240
Entry
BSU27240          CDS       T00010                                 

Gene name
yrhC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YrhC
Other DBs
NCBI-GeneID: 936495
NCBI-ProteinID: NP_390602
Pasteur: BG12292
BSORF: BG12292
UniProt: O05395 A0A6M4JMS7
Position
complement(2784688..2784918)
AA seq 76 aa
MNKNRMKSLKEDYKHFAFTLLAVSTFLYIGAVLPDQGLTLGQKSTMFLADCVFLAGAFFC
ADRSLIYKKRLEEADE
NT seq 231 nt   +upstreamnt  +downstreamnt
ttgaacaaaaatagaatgaaatctttaaaagaagactacaagcattttgcttttacattg
cttgcagtcagcacttttttatatataggcgcagttctccctgatcaaggcttaacatta
ggccagaaatcgacgatgtttttagcggattgcgtatttttagccggtgccttcttttgc
gctgaccgttcacttatttacaagaagcgtctggaagaagccgacgaataa

DBGET integrated database retrieval system