KEGG   Bacillus subtilis subsp. subtilis 168: BSU27250
Entry
BSU27250          CDS       T00010                                 

Symbol
yrhB
Name
(RefSeq) cystathionine gamma-lyase
  KO
K17217  cystathionine gamma-lyase / homocysteine desulfhydrase [EC:4.4.1.1 4.4.1.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00260  Glycine, serine and threonine metabolism
bsu00270  Cysteine and methionine metabolism
bsu00920  Sulfur metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01230  Biosynthesis of amino acids
Module
bsu_M00609  Cysteine biosynthesis, methionine => cysteine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BSU27250 (yrhB)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU27250 (yrhB)
   00270 Cysteine and methionine metabolism
    BSU27250 (yrhB)
Enzymes [BR:bsu01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.1  cystathionine gamma-lyase
     BSU27250 (yrhB)
    4.4.1.2  homocysteine desulfhydrase
     BSU27250 (yrhB)
SSDB
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Met_gamma_lyase
Other DBs
NCBI-GeneID: 936947
NCBI-ProteinID: NP_390603
Pasteur: BG12291
BSORF: BG12291
UniProt: O05394 A0A6M3ZEV1
Position
complement(2785001..2786140)
AA seq 379 aa
MKKKTLMIHGGITGDEKTGAVSVPIYQVSTYKQPKAGQHTGYEYSRTANPTRTALEALVT
ELESGEAGYAFSSGMAAITAVMMLFNSGDHVVLTDDVYGGTYRVMTKVLNRLGIESTFVD
TSSREEVEKAIRPNTKAIYIETPTNPLLKITDLTLMADIAKKAGVLLIVDNTFNTPYFQQ
PLTLGADIVLHSATKYLGGHSDVVGGLVVTASKELGEELHFVQNSTGGVLGPQDSWLLMR
GIKTLGLRMEAIDQNARKIASFLENHPAVQTLYYPGSSNHPGHELAKTQGAGFGGMISFD
IGSEERVDAFLGNLKLFTIAESLGAVESLISVPARMTHASIPRERRLELGITDGLIRISV
GIEDAEDLLEDIGQALENI
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgaagaaaaaaacattgatgatacatggcggaatcacaggtgatgagaaaacaggcgca
gtttccgtgccgatttatcaagtaagcacgtacaagcagccgaaagcagggcagcataca
ggctacgagtattcaagaacggccaatccgactcgaaccgctctcgaagcacttgtgaca
gaactggaaagcggggaagcaggctatgcgttcagctcaggaatggctgccattacagcg
gttatgatgctgtttaacagcggagatcatgtcgtgttgactgatgatgtgtacggcgga
acatatcgcgtgatgacaaaggtgcttaaccgtcttggcattgaatcaacatttgttgat
acgagcagcagggaagaagttgaaaaagcgattcgccctaatacaaaagcaatttatatt
gaaacaccgacaaacccgttgctcaaaatcaccgacctgacgctcatggctgatatcgca
aaaaaagcgggtgttctgcttatcgtagacaatacctttaatactccttattttcaacag
ccgcttactttaggcgctgatatcgtactgcacagtgcgacaaaatatcttggcggacac
agtgatgtcgtcggaggtttagttgtgacagcttcgaaagagcttggagaagagctgcat
tttgtgcaaaactccacaggcggcgtgctcggccctcaagattcctggctgttaatgaga
ggaatcaaaacgttgggactcagaatggaagcgatcgatcaaaatgcgcggaaaatcgca
agctttcttgagaatcaccctgctgtccaaacgttatattaccctggttcttcaaatcat
cccggacatgagcttgcaaaaacgcaaggagcgggcttcggcggcatgatctcctttgat
attggcagtgaagaacgggttgatgcgtttttaggaaatctgaaactgtttaccattgct
gaaagcctgggggcggttgaaagcttaatttctgttcctgcaagaatgacacatgcctct
attccgagagaacgccggcttgagctcggcattacggacggcttgatcagaatttctgta
ggaattgaagatgcggaagacttgttggaagatatcggccaagcgcttgaaaatatataa

DBGET integrated database retrieval system