KEGG   Bacillus subtilis subsp. subtilis 168: BSU27260
Entry
BSU27260          CDS       T00010                                 

Symbol
mccA
Name
(RefSeq) O-acetylserine dependent cystathionine beta-synthase
  KO
K17216  cystathionine beta-synthase (O-acetyl-L-serine) [EC:2.5.1.134]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00270  Cysteine and methionine metabolism
bsu01100  Metabolic pathways
bsu01230  Biosynthesis of amino acids
Module
bsu_M00609  Cysteine biosynthesis, methionine => cysteine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BSU27260 (mccA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.134  cystathionine beta-synthase (O-acetyl-L-serine)
     BSU27260 (mccA)
SSDB
Motif
Pfam: PALP
Other DBs
NCBI-GeneID: 937576
NCBI-ProteinID: NP_390604
Pasteur: BG12290
BSORF: BG12290
UniProt: O05393 A0A6M3ZEC8
Position
complement(2786142..2787065)
AA seq 307 aa
MTVITDITELIGNTPLLRLKNFDVPEGVAVYAKLEMMNPGGSIKDRLGDMLIRDALDSGK
VKPGGVIIEATAGNTGIGLALSARKYGLKAIFCVPEHFSREKQQIMQALGASIIHTPRQD
GMQGAIQKAIQLETEIENSYCVLQFKNRVNPSTYYKTLGPEMWEALDGNIHTFVAGAGSG
GTFAGTASFLKEKNPAVKTVIVEPVGSILNGGEPHAHKTEGIGMEFIPDYMDKSHFDEIY
TVTDENAFRLVKEAAEKEGLLIGSSSGAALYAALEEAKKASAGTNIVTVFPDSSDRYISK
QIYEGGI
NT seq 924 nt   +upstreamnt  +downstreamnt
atgacagtgattacggacattaccgagctgattgggaatacaccgcttctccgcttgaag
aactttgatgttccagaaggagtcgcggtgtatgccaagcttgaaatgatgaatccaggg
ggaagcatcaaagacagactgggagatatgctgattcgtgacgcgctcgattcaggcaaa
gtgaaacccggcggagtgattatagaagctacggcaggcaatacagggatcggccttgcg
ttaagtgccagaaaatatgggctgaaagcgattttctgtgtccctgaacatttcagcaga
gagaaacagcaaattatgcaagcgcttggcgcatcaatcattcatacaccgcgtcaagac
ggaatgcagggagccattcaaaaagccattcagctggagactgaaattgaaaattcttat
tgcgttttgcaatttaaaaaccgagtaaatccatcgacttactataagacgcttggacct
gaaatgtgggaagcgcttgacgggaatattcatacatttgtcgcaggggcaggatcagga
ggcacattcgcagggacagcttccttcttaaaagaaaaaaatccagcagtcaaaacggtg
attgttgaaccggtgggctcgattttaaacggaggagagccccacgctcataaaacagag
ggcatcggcatggagtttatccccgattatatggataagagccattttgacgagatctac
accgtaacagatgagaatgcgtttagacttgtgaaagaagcggcagaaaaagaaggcctg
ctgatcggaagctcttcaggtgcagcgctttatgcggcattggaggaagcgaaaaaagca
tccgctggaactaacattgtcacagtatttcctgacagcagcgatcgatatatcagcaaa
caaatatacgaaggaggcatctga

DBGET integrated database retrieval system