KEGG   Bacillus subtilis subsp. subtilis 168: BSU27270
Entry
BSU27270          CDS       T00010                                 

Symbol
mtn
Name
(RefSeq) 5'-methylthioadenosine/s-adenosylhomocysteine nucleosidase
  KO
K01243  adenosylhomocysteine nucleosidase [EC:3.2.2.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00270  Cysteine and methionine metabolism
bsu01100  Metabolic pathways
bsu01230  Biosynthesis of amino acids
Module
bsu_M00034  Methionine salvage pathway
bsu_M00609  Cysteine biosynthesis, methionine => cysteine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BSU27270 (mtn)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.9  adenosylhomocysteine nucleosidase
     BSU27270 (mtn)
SSDB
Motif
Pfam: PNP_UDP_1 PAG
Other DBs
NCBI-GeneID: 938153
NCBI-ProteinID: NP_390605
Pasteur: BG13800
BSORF: BG13800
UniProt: O32028 A0A6M4JNK4
Position
complement(2787130..2787825)
AA seq 231 aa
MRLAVIGAMEEEVTILRNKLENAKTETIAHCEFTTGEYEGTEVILLKSGIGKVNAAISTT
LLLDRYKPDYVINTGSAGGFHHTLNVGDVVISTDVRHHDVDVTAFDYEYGQVPGLPAAYA
ADEKLISITEEAVSELDGIQVAKGTIATGDSFMNDPKRVEEVRARFSDLYAVEMEAAAVA
QVCHQFKTPFVVIRALSDIAGKESHVSFDQFLEQAAVHSTELVLKVIKRIH
NT seq 696 nt   +upstreamnt  +downstreamnt
atgagactagcagtcatcggagcaatggaagaggaagttaccatcttaagaaacaaactt
gaaaatgcaaaaacagaaacgatcgcacactgtgaatttacaacaggcgaatatgaagga
actgaagtgattcttttaaaatcaggaattggaaaagtaaatgctgctatcagcacgacg
cttctgcttgaccgttacaagcctgattatgtcattaacacaggctcagccggcggattt
catcatacattgaatgtaggggatgtcgtcatttccactgacgttcgccaccatgatgta
gacgtaacggcttttgactatgaatacggccaagtgccgggtcttccggctgcttatgcg
gcggatgaaaagctgatcagcatcactgaagaagcggtatctgaactcgacggcattcag
gttgcaaaaggaacgattgcaacaggcgattctttcatgaacgatccgaagcgggttgaa
gaggtgcgtgcgagattttctgatctgtacgcggttgaaatggaggctgcggcagtggct
caagtatgccatcaatttaaaacgccgtttgtcgtcatcagagcgttatcagatatcgca
ggcaaagaatcacatgtttcatttgaccaatttttagagcaggcggctgttcattcaaca
gagcttgtgttaaaggtgatcaaacgaattcattaa

DBGET integrated database retrieval system