KEGG   Bacillus subtilis subsp. subtilis 168: BSU27280Help
Entry
BSU27280          CDS       T00010                                 

Gene name
yrrT
Definition
(RefSeq) methyltransferase
  KO
K17462  putative AdoMet-dependent methyltransferase [EC:2.1.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00270  Cysteine and methionine metabolism
bsu01100  Metabolic pathways
bsu01230  Biosynthesis of amino acids
Module
bsu_M00609  Cysteine biosynthesis, methionine => cysteine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BSU27280 (yrrT)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     BSU27280 (yrrT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_12 RrnaAD Methyltransf_31 Ubie_methyltran CMAS Methyltransf_28 DUF2383
Motif
Other DBs
NCBI-GeneID: 937566
NCBI-ProteinID: NP_390606
Pasteur: BG13799
BSORF: BG13799
UniProt: O32029
Position
complement(2787846..2788487)
Genome map
AA seq 213 aa AA seqDB search
MGREFIPLFEDWAATYDQTVQGLDIQYKEAFRGYDHILDAIVRKSGTHVLEFGPGTGNLT
AKLLDAGKTVFGIEPSPAMRKLASDKLSGRTEIVDGDFLTFPEPPFQADTIVSSYAFHHL
TDEEKRAAIKQYGKYLHLHDKIVFADTVFENAQAYQQAIDKARSQGFYQLANDLETEHYP
TLDALKEMFTAEGFAVRFTQQNDFVWIMEAIKR
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgggccgtgaatttatccctctctttgaagattgggcagcaacttatgatcaaacagta
caaggtttagatattcagtataaagaagcgttcagaggctacgatcatatccttgatgcc
atcgtcagaaaatctggaacgcatgtgttagaatttggcccggggaccgggaatttgaca
gctaagctgctcgatgcaggcaaaactgtatttggaatcgaaccttctccagcaatgcgt
aaactggcttctgacaagctctcaggcaggacggaaatcgttgatggagacttcctgaca
ttccctgagccgccatttcaggctgatacgattgtcagttcatatgcttttcatcatttg
actgacgaagaaaagcgggctgccataaagcaatatggcaaataccttcacttgcatgat
aaaatagtgtttgccgataccgtctttgaaaatgcgcaagcgtatcaacaggctatcgat
aaagcccgttctcaaggcttttatcagcttgcaaatgatttagagacagagcattatcct
acattggatgcgttgaaagaaatgtttacagctgaaggttttgcagtccgattcactcag
caaaacgacttcgtgtggataatggaggcgatcaaacggtaa

DBGET integrated database retrieval system