KEGG   Bacillus subtilis subsp. subtilis 168: BSU27290
Entry
BSU27290          CDS       T00010                                 

Symbol
yrzA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2536 AMP-binding_C_2 SBE2 eIF-5a MtrG
Other DBs
NCBI-GeneID: 937564
NCBI-ProteinID: NP_390607
Pasteur: BG13811
BSORF: BG13811
UniProt: O32030 A0A6M3ZHT7
Position
2788680..2788883
AA seq 67 aa
MNFQLDLIKDKVEFFEAASLQELEKKINTQIENNKAIMLRVKSVSHQTLVAEGRILYSAV
VHFSAEA
NT seq 204 nt   +upstreamnt  +downstreamnt
atgaattttcaattagatctgattaaagacaaagtggaattttttgaagcggcttcattg
caggagcttgaaaagaaaatcaatacacaaattgaaaacaataaagccatcatgctccgg
gtgaaatctgtttcacaccaaactcttgtggcagaaggaagaatattgtacagcgcggtg
gttcatttctcagctgaagcctaa

DBGET integrated database retrieval system