KEGG   Bacillus subtilis subsp. subtilis 168: BSU27310Help
Entry
BSU27310          CDS       T00010                                 

Gene name
pbpI
Definition
(RefSeq) penicillin-binding protein 4B
  KO
K21468  penicillin-binding protein 4B
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
    BSU27310 (pbpI)
Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   BSU27310 (pbpI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer Sigma70_r3 CopK
Motif
Other DBs
NCBI-GeneID: 936016
NCBI-ProteinID: NP_390609
Pasteur: BG13797
BSORF: BG13797
UniProt: O32032
Position
complement(2789686..2791440)
Genome map
AA seq 584 aa AA seqDB search
MKISKRMKLAVIAFLIVFFLLLLRLAEIQLFFTESFSKKKINLIQESVKQRTEEVLISDG
RGSFLDRNGRALTGQSEPAVVLFPFLLTQDWPIKKVADILGMSEDDLRQTLGQAKKPVIL
QQKKIKTLSKQSITKINSLKYPGIYGVYMENEDKPSLASHTIGSTNQDPALLRKKYPDKE
SLPITTEIGTTGLERTFDEFLLPEQDTKLLYHVDGKGNPLFGMDVKYTAEANTFYPLQIK
TTIDQSIQKAMEEVLDEQGLKKGGAVLLDIENSSVLGIVSKPDADVSRQNTLQNYMLTPI
YPGSVFKTVIAAAAIENNMVKPSQTFNCNLNLYGEPGDDKGTLSFDESFAQSCNYTFTSL
AEQLMKKDSSVIEDMSEKLALTDRAGWEGKLYHETDFRQLYNEKSGVIWGDEKDKSVKKA
IAQTAIGQKNVKVTPLEVANMMATIARGGEKRQVKIAEQIEYKNGTTLVTFKDQKLKGET
IDKYTSQQLQKILRRVVESPSGTGRRFQDLPYTVAGKSGTAQTGKLSKEKETLYEKWFAG
YFPADKPKYALVVLHMDTPGDKALTNSVFYDIVKKVHEIEINQK
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgaagatatcgaaacgaatgaagctggcagtcatcgcttttttgattgtattttttctg
cttctgctgagacttgcagaaatccagctgtttttcacagaatcattttctaaaaagaaa
attaatttgattcaagaaagtgtgaaacagcggacggaggaagtgctcatttcagatgga
agaggctcttttttagatcgaaacgggcgggcgctgacaggacaaagcgagcctgcggtt
gttttgttcccttttctgctgacgcaggattggccgatcaaaaaagttgcggacatcctc
ggcatgtctgaagatgatttgcgccagacactaggtcaggcaaaaaaaccggtcattttg
cagcaaaagaaaatcaaaacactttcaaaacaatctatcacaaaaatcaattctttgaaa
tatcccggcatttacggcgtatatatggagaatgaagacaagcccagccttgcttcacat
acgatagggagcacgaaccaagatccggcgctgcttcgcaagaaatatcctgacaaggag
agccttccgattacaacagaaatcggaacaaccggtttagaacggacatttgacgagttt
ttgcttccggaacaagacacaaagcttttatatcatgtggacggaaaaggaaaccctttg
tttggcatggacgtcaaatatacagctgaagccaatacattttatccgctccagatcaaa
acaacgatcgatcaaagcattcaaaaagcgatggaggaggtattggatgaacaggggctg
aaaaagggaggagctgtgctgctggacatcgaaaatagcagtgttctgggaattgtaagc
aaaccagatgcagacgtgtcccggcaaaacacacttcaaaattatatgctgacgccaatc
tatcccggatcagtttttaaaacagtcattgccgcagctgcaatcgaaaataatatggtg
aagcctagtcaaacctttaattgcaatttaaacctgtacggggaaccgggggacgacaaa
ggcaccttgtcttttgatgaaagttttgcccaaagctgtaattacacatttacgagtctt
gcagaacaattaatgaaaaaagacagctcggttattgaagatatgtccgagaagctggct
ctcactgatcgggcaggctgggagggaaaactgtaccacgaaaccgatttccgccagctg
tataacgaaaaaagcggcgtgatttggggggatgaaaaagacaaatcagtcaaaaaagcc
attgcgcaaacagcaatcgggcagaaaaatgtaaaggtaacgccgctggaggtagccaat
atgatggcgacaatcgcccgcggcggagaaaaacggcaggtgaaaattgccgaacaaatt
gagtataagaacggcacaacgctcgttacgtttaaagatcagaagctcaaaggggaaacg
atagacaaatatacgtcacagcagcttcaaaaaatactgcggcgggtagtagaatctcct
tccggaacgggcagaaggtttcaagatcttccgtatactgtagcagggaagtcgggcaca
gcccagacaggcaagctttcaaaagagaaggaaacgctctacgaaaaatggtttgccgga
tattttcccgcggataagccgaaatacgctctagttgttttacacatggatacaccggga
gataaggctctgacaaattcggtgttttatgatattgttaaaaaagtacacgaaattgaa
atcaatcagaaatag

DBGET integrated database retrieval system