KEGG   Bacillus subtilis subsp. subtilis 168: BSU27320
Entry
BSU27320          CDS       T00010                                 
Symbol
greA
Name
(RefSeq) transcription elongation factor GreA
  KO
K03624  transcription elongation factor GreA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsu03021]
    BSU27320 (greA)
Transcription machinery [BR:bsu03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    Transcription elongation factors
     BSU27320 (greA)
SSDB
Motif
Pfam: GreA_GreB_N GreA_GreB BET N_formyltrans_C
Other DBs
NCBI-GeneID: 937565
NCBI-ProteinID: NP_390610
Pasteur: BG19019
BSORF: BG19019
UniProt: P80240 A0A6M4JLZ2
Position
complement(2791494..2791967)
AA seq 157 aa
MAQEKVFPMTAEGKQKLEQELEYLKTVKRKEVVERIKIARSFGDLSENSEYDSAKEEQAF
VEGRVTTLENMIRNAKIIEDDGGSNVVGLGKTVTFVELPDGDEESYTIVGSAEADPFEGK
ISNDSPIAKSLLGKKVDEEVTVQTPGGEMLVKIVKIS
NT seq 474 nt   +upstreamnt  +downstreamnt
atggcacaagagaaagtttttcctatgactgcagaaggaaaacaaaaacttgaacaagaa
ttagaatatttgaaaacggttaaacgaaaagaagtagtagagcgaatcaaaattgcgaga
agcttcggagacctttccgagaactctgaatacgattcagcgaaagaagagcaggcattt
gtagagggccgcgtgacgactcttgaaaatatgattcgcaatgcgaaaatcattgaagat
gacggcggctctaacgttgtcggtttgggtaaaaccgtcactttcgtcgaactgcctgac
ggtgatgaagaatcatatacgatcgtcggaagcgcggaagctgacccgtttgaagggaaa
atctcaaacgattcaccgatcgcaaaaagcctcttgggcaaaaaagtagatgaagaagtc
acagtacaaacaccgggcggagaaatgctcgtgaaaattgtgaaaatttcataa

DBGET integrated database retrieval system