KEGG   Bacillus subtilis subsp. subtilis 168: BSU27320Help
Entry
BSU27320          CDS       T00010                                 

Gene name
greA
Definition
(RefSeq) transcription elongation factor GreA
  KO
K03624  transcription elongation factor GreA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsu03021]
    BSU27320 (greA)
Transcription machinery [BR:bsu03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    Transcription elongation factors
     BSU27320 (greA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GreA_GreB_N GreA_GreB BET Kri1
Motif
Other DBs
NCBI-GeneID: 937565
NCBI-ProteinID: NP_390610
Pasteur: BG19019
BSORF: BG19019
UniProt: P80240
Position
complement(2791494..2791967)
Genome map
AA seq 157 aa AA seqDB search
MAQEKVFPMTAEGKQKLEQELEYLKTVKRKEVVERIKIARSFGDLSENSEYDSAKEEQAF
VEGRVTTLENMIRNAKIIEDDGGSNVVGLGKTVTFVELPDGDEESYTIVGSAEADPFEGK
ISNDSPIAKSLLGKKVDEEVTVQTPGGEMLVKIVKIS
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atggcacaagagaaagtttttcctatgactgcagaaggaaaacaaaaacttgaacaagaa
ttagaatatttgaaaacggttaaacgaaaagaagtagtagagcgaatcaaaattgcgaga
agcttcggagacctttccgagaactctgaatacgattcagcgaaagaagagcaggcattt
gtagagggccgcgtgacgactcttgaaaatatgattcgcaatgcgaaaatcattgaagat
gacggcggctctaacgttgtcggtttgggtaaaaccgtcactttcgtcgaactgcctgac
ggtgatgaagaatcatatacgatcgtcggaagcgcggaagctgacccgtttgaagggaaa
atctcaaacgattcaccgatcgcaaaaagcctcttgggcaaaaaagtagatgaagaagtc
acagtacaaacaccgggcggagaaatgctcgtgaaaattgtgaaaatttcataa

DBGET integrated database retrieval system