KEGG   Bacillus subtilis subsp. subtilis 168: BSU27330
Entry
BSU27330          CDS       T00010                                 
Symbol
udk
Name
(RefSeq) uridine kinase
  KO
K00876  uridine kinase [EC:2.7.1.48]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00240  Pyrimidine metabolism
bsu01100  Metabolic pathways
bsu01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BSU27330 (udk)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.48  uridine/cytidine kinase
     BSU27330 (udk)
SSDB
Motif
Pfam: PRK AAA_18 CoaE Zeta_toxin ABC_tran AAA_16 DO-GTPase2 KAP_NTPase CPT AAA_24 AAA_22 cobW AAA_19
Other DBs
NCBI-GeneID: 937560
NCBI-ProteinID: NP_390611
Pasteur: BG12696
BSORF: BG12696
UniProt: O32033 A0A6M4JLF4
Position
complement(2792218..2792853)
AA seq 211 aa
MGKNPVVIGIAGGSGSGKTSVTRSIYEQFKGHSILMIQQDLYYKDQSHLPFEERLNTNYD
HPLAFDNDYLIEHIQDLLNYRPIEKPIYDYKLHTRSEETVHVEPKDVIILEGILVLEDKR
LRDLMDIKLYVDTDADLRIIRRIMRDINERGRSIDSVIEQYVSVVRPMHNQFVEPTKRYA
DIIIPEGGQNHVAIDLMVTKIQTILEQNAIL
NT seq 636 nt   +upstreamnt  +downstreamnt
atgggtaagaatccagtagtcattggaatcgcaggaggttccggttcaggaaaaacgagt
gtcacacggtccatttatgaacagtttaaaggacactcaattttaatgatccagcaggac
ctttattataaagaccaaagccatcttccgtttgaagaaaggctgaacacaaactatgat
catccgcttgcgtttgataatgactatttaatcgagcatattcaagatctattgaattac
cgcccgattgaaaagccgatttatgactataagcttcacacacgttcagaagaaacggtt
cacgtagagccaaaggatgttattatccttgaaggcattcttgttcttgaagacaaaagg
cttcgtgatctgatggatatcaagctttatgttgatacggacgctgacttgcgtatcatc
agacggattatgagagatattaatgagcgcggacgctctattgattctgtcattgaacaa
tatgtgtcagtggtccgtccgatgcataaccaattcgtcgagccgacgaaacgatacgct
gatattattatcccggaaggcggtcagaatcacgtcgcaattgatctgatggtcacaaaa
attcaaaccattcttgaacaaaacgcgattttgtaa

DBGET integrated database retrieval system