KEGG   Bacillus subtilis subsp. subtilis 168: BSU27340Help
Entry
BSU27340          CDS       T00010                                 

Gene name
yrrO
Definition
(RefSeq) protease YrrO
  KO
K08303  putative protease [EC:3.4.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bsu01002]
    BSU27340 (yrrO)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     BSU27340 (yrrO)
Peptidases [BR:bsu01002]
 Peptidases of Unknown Catalytic Type
  Family U32
   BSU27340 (yrrO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_U32 Peptidase_U32_C Radical_SAM LPD15 PucR
Motif
Other DBs
NCBI-GeneID: 937561
NCBI-ProteinID: NP_390612
Pasteur: BG13796
BSORF: BG13796
UniProt: O32034
Position
complement(2792860..2794128)
Genome map
AA seq 422 aa AA seqDB search
MTAVNDKISTIVNGKRVITKKPELLAPAGNLEKLKIAVHYGADAVFIGGQEYGLRSNADN
FTIEEIAEGVEFAKKYGAKIYVTTNIFAHNENMDGLEDYLKALGDANVAGIIVADPLIIE
TCRRVAPNVEVHLSTQQSLSNWKAVQFWKEEGLDRVVLARETSALEIREMKEKVDIEIES
FIHGAMCIAYSGRCVLSNHMTARDSNRGGCCQSCRWDYDLYQTDGANAVALYGEEDAPFA
MSPKDLKLIESIPKMIEMGIDSLKIEGRMKSIHYVATVVSVYRKVIDAYCADPENFVIQK
EWLEELDKCANRDTATAFFEGTPGYEEQMFGEHAKKTTYDFVGLVLNYDEDTQMVTLQQR
NFFKKGDEVEFFGPEIENFTHTIETIWDEDGNELDAARHPLQIVKFKLDKKIYPSNMMRK
GK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgactgccgtaaatgataaaatatccacaatcgttaatggaaagcgtgtgattacgaaa
aagccggagcttctcgcacctgcgggtaatcttgaaaagctgaaaatcgctgttcattac
ggagcggacgcggtctttatcgggggacaggaatacgggcttcgctcgaatgccgataac
tttacgatcgaagaaattgcagaaggcgttgaattcgcaaagaaatatggcgcgaagatc
tacgtaacaacgaatattttcgctcataatgaaaacatggacgggcttgaagactattta
aaagcgcttggagacgccaacgttgccggtattattgtggcagatccgcttattattgaa
acatgccgcagagtggcgccgaatgttgaggttcacttgagcacacagcagtctctttca
aactggaaggctgtccagttctggaaggaagaaggtctcgaccgcgtcgtgctggcacgt
gaaactagcgctcttgaaatcagagaaatgaaagaaaaggtagatatcgaaatcgaatcc
ttcattcatggcgcaatgtgtattgcatattccggccgctgcgtgctgagcaatcacatg
acagcgcgggattccaaccgcggaggctgctgccagtcatgccgctgggattatgatctc
taccaaacagacggtgccaacgccgttgctttgtatggtgaagaagatgcaccatttgcg
atgagcccgaaagatttgaagctgattgaatccattccaaaaatgattgaaatggggatc
gacagcttaaagattgaaggccgcatgaaatccattcactatgtagcaactgttgtcagc
gtataccgcaaagtaatcgatgcttattgcgctgatccagaaaactttgtgattcaaaaa
gaatggcttgaagagcttgataagtgcgccaacagggacactgcgacagctttctttgaa
ggaacgccaggctatgaagagcaaatgttcggcgaacacgccaagaaaacgacatatgat
tttgtcggcttagtgctgaattatgatgaagatacacaaatggtcacgcttcagcagcgc
aatttcttcaaaaaaggcgacgaagtggaatttttcggtccagaaatcgaaaactttaca
catacgattgaaaccatttgggacgaagacggaaatgagctagatgctgcccgccatccc
ctgcaaattgtcaaattcaaactagacaaaaagatttatccgagcaacatgatgagaaag
gggaagtaa

DBGET integrated database retrieval system