KEGG   Bacillus subtilis subsp. subtilis 168: BSU27350Help
Entry
BSU27350          CDS       T00010                                 

Gene name
yrrN
Definition
(RefSeq) protease YrrN
  KO
K08303  putative protease [EC:3.4.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bsu01002]
    BSU27350 (yrrN)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     BSU27350 (yrrN)
Peptidases [BR:bsu01002]
 Peptidases of Unknown Catalytic Type
  Family U32
   BSU27350 (yrrN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_U32
Motif
Other DBs
NCBI-GeneID: 937559
NCBI-ProteinID: NP_390613
Pasteur: BG13795
BSORF: BG13795
UniProt: O32035
Position
complement(2794147..2795076)
Genome map
AA seq 309 aa AA seqDB search
MKKPELLVTPTSTADILPLIQAGATAFLVGEQRYGLRLAGEFSREDVTKAVEIAHKEGAK
VYVAVNAIFHNDKVGELGEYLAFLAEAGVDAAVFGDPAVLMAARESAPDLKLHWSTETTG
TNYYTCNYWGRKGAARSVLARELNMDSIVEIKENAEVEIEIQVHGMTCMFQSKRSLIGNY
FEYQGKVMDIERKKKESGMFLHDKERDNKYPIFEDENGTHIMSPNDVCIIDELEELIDAG
IDSFKIDGVLKMPEYLIEVTKMYREAIDLCVENRDEYEAKKEDWIERIESIQPVNRKIDT
GFFFKETVY
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaccagagctcttagtgacgccgacgagtacagcggacattttgccgctcata
caggctggggcaactgcgtttttagttggggaacagagatacggcttgagattagccgga
gaattttctcgtgaagatgtaacaaaagccgtagagattgctcacaaagaaggggcaaaa
gtatacgttgctgtaaatgcaattttccataatgataaagtgggtgagcttggcgaatat
ctggctttcttagcagaagccggtgtcgatgcagcggtattcggcgatcctgccgtgctg
atggctgcccgtgaatctgcgcctgatctgaagcttcattggagcacagaaacgacaggc
accaactattatacatgcaactactggggacgcaagggtgcggcgcgttctgtgcttgcc
agagaattaaacatggacagcattgttgagattaaagaaaatgctgaagtcgaaattgaa
atccaggtgcatggaatgacgtgcatgttccaatcgaagcgttctttgattggaaactat
tttgaatatcagggcaaagtcatggacattgaaagaaagaaaaaagaatcaggcatgttt
ttacacgataaagaacgcgataataaatatccgattttcgaagatgaaaacggcactcac
atcatgagcccgaacgatgtgtgcatcattgatgagctcgaggaattgatagatgccgga
attgattctttcaaaatcgatggtgttttgaaaatgcctgaatacctaatagaagtcacc
aaaatgtacagagaagcaattgatttgtgcgtggaaaaccgtgacgaatacgaagcgaaa
aaagaagactggatcgaacgcattgaaagcatccagccagtaaacagaaaaattgatacc
ggattcttcttcaaggaaacggtttattaa

DBGET integrated database retrieval system