KEGG   Bacillus subtilis subsp. subtilis 168: BSU27360Help
Entry
BSU27360          CDS       T00010                                 

Gene name
yrrM
Definition
(RefSeq) O-methyltransferase YrrM
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_3 Methyltransf_24 PCMT Methyltransf_31 GCD14 Methyltransf_18 CMAS MTS Methyltransf_15 Methyltransf_4 GidB Cons_hypoth95 Methyltransf_25 CmcI Spermine_synth DUF938 Methyltransf_23 Met_10 Methyltr_RsmB-F
Motif
Other DBs
NCBI-GeneID: 937719
NCBI-ProteinID: NP_390614
Pasteur: BG13794
BSORF: BG13794
UniProt: O32036
Structure
PDB: 

Position
complement(2795082..2795735)
Genome map
AA seq 217 aa AA seqDB search
MTDRYEQINDYIEALLKPRPDNVKRLEAYAEEHHVPIMEKAGMEVLLQILSVKQPKKILE
IGTAIGYSAIRMALELPSAEIYTIERNEKRHEEAVNNIKEFQLDDRIHVFYGDALELADA
VHVTAPYDVIFIDAAKGQYQNFFHLYEPMLSPDGVIITDNVLFKGLVAEDYSKIEPKRRR
RLVAKIDEYNHWLMNHPDYQTAIIPVGDGLAISKKKR
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
gtgactgaccggtatgaacaaataaatgactatatagaagcattattaaagcctcggccg
gataacgtgaagagacttgaagcatatgcagaagaacatcatgtcccgattatggaaaaa
gcgggcatggaggtgctgcttcaaattttgtctgtgaaacagccgaaaaaaatactagaa
atcggaacggccattggttattcagccattcgaatggctctggaactgccgtctgctgaa
atatatacaattgaacgcaatgagaaacggcatgaagaagcggtaaacaatatcaaggaa
tttcagcttgatgaccggattcatgttttttacggagatgcgcttgaattagccgacgcc
gttcatgtaaccgcgccttacgatgtcatttttattgacgctgcaaaaggtcagtatcaa
aacttttttcatttatatgaaccgatgctttcaccggacggggtgattataacagacaac
gtgctgtttaaaggtctggtggcagaggattacagcaaaatagaaccgaagagaaggcgc
aggcttgtagccaaaattgatgaatataatcattggctgatgaatcatccggattatcaa
actgcgattattcctgtcggggacggacttgcgattagtaaaaagaagaggtga

DBGET integrated database retrieval system