KEGG   Bacillus subtilis subsp. subtilis 168: BSU27360
Entry
BSU27360          CDS       T00010                                 

Symbol
yrrM
Name
(RefSeq) O-methyltransferase YrrM
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Methyltransf_3 Methyltransf_24 PCMT Methyltransf_31 GCD14 MTS CMAS Methyltransf_15 Methyltransf_4 Methyltransf_18 GidB Cons_hypoth95 Methyltransf_25 Spermine_synth DUF938 Methyltransf_23 Methyltransf_17 Met_10 Methyltr_RsmB-F
Other DBs
NCBI-GeneID: 937719
NCBI-ProteinID: NP_390614
Pasteur: BG13794
BSORF: BG13794
UniProt: O32036 A0A6M3ZED8
Structure
Position
complement(2795082..2795735)
AA seq 217 aa
MTDRYEQINDYIEALLKPRPDNVKRLEAYAEEHHVPIMEKAGMEVLLQILSVKQPKKILE
IGTAIGYSAIRMALELPSAEIYTIERNEKRHEEAVNNIKEFQLDDRIHVFYGDALELADA
VHVTAPYDVIFIDAAKGQYQNFFHLYEPMLSPDGVIITDNVLFKGLVAEDYSKIEPKRRR
RLVAKIDEYNHWLMNHPDYQTAIIPVGDGLAISKKKR
NT seq 654 nt   +upstreamnt  +downstreamnt
gtgactgaccggtatgaacaaataaatgactatatagaagcattattaaagcctcggccg
gataacgtgaagagacttgaagcatatgcagaagaacatcatgtcccgattatggaaaaa
gcgggcatggaggtgctgcttcaaattttgtctgtgaaacagccgaaaaaaatactagaa
atcggaacggccattggttattcagccattcgaatggctctggaactgccgtctgctgaa
atatatacaattgaacgcaatgagaaacggcatgaagaagcggtaaacaatatcaaggaa
tttcagcttgatgaccggattcatgttttttacggagatgcgcttgaattagccgacgcc
gttcatgtaaccgcgccttacgatgtcatttttattgacgctgcaaaaggtcagtatcaa
aacttttttcatttatatgaaccgatgctttcaccggacggggtgattataacagacaac
gtgctgtttaaaggtctggtggcagaggattacagcaaaatagaaccgaagagaaggcgc
aggcttgtagccaaaattgatgaatataatcattggctgatgaatcatccggattatcaa
actgcgattattcctgtcggggacggacttgcgattagtaaaaagaagaggtga

DBGET integrated database retrieval system