KEGG   Bacillus subtilis subsp. subtilis 168: BSU27370Help
Entry
BSU27370          CDS       T00010                                 

Gene name
yrrL
Definition
(RefSeq) hypothetical protein
  KO
K07082  UPF0755 protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BSU27370 (yrrL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YceG TFX_C
Motif
Other DBs
NCBI-GeneID: 936260
NCBI-ProteinID: NP_390615
Pasteur: BG13793
BSORF: BG13793
UniProt: O34758
Position
complement(2795887..2796969)
Genome map
AA seq 360 aa AA seqDB search
MYINQQKKSFFNKKRIILSSIVVLFLIIGGAFLYGKSLLEPVEKDSKTTVNINIPSGSSV
SAIASILKKNDVIKSEKAFQYYVKYKGASGFQAGFYHLNKGMDLDAIIQKLTSGATGYAF
QITVTEGAQLTQIAAAIADETKYSKKQVIAKLDDETFINQLKKEFPDTVTNDVFNKNIKH
PLEGYLFPATYPFNDPDTSLEDIIKAMIKQTNSYVETYKSEMKKNKVSVHKLLTMASLIE
EEATEKADRHKIASVFYNRLKKKMPLQTDPTVLYAAGKHKDRVLYKDLEIDSPYNTYKNT
GLTPGPIANAGMSSWEAALHPDKTDYLYFLAKSNGEVVFTKTLKEHNKAKEKYISSKNEK
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtatatcaatcagcaaaaaaaatcgttttttaataaaaaaagaatcatactgtcttcc
attgttgtgctgtttctcatcattggcggggcatttttatatgggaaatcattgcttgaa
cctgttgaaaaagacagtaaaacgacagttaatattaacattccgagcggttcgtctgtt
tcagccatcgcatcgatattaaagaaaaatgatgtcataaaaagcgagaaggcgtttcag
tactatgtgaaatataaaggtgcttccgggtttcaggccggattctaccatctgaataaa
ggtatggatttagatgccattattcagaagctgacaagcggggctacaggttacgctttt
caaatcacagtgactgagggagcacagctgacccaaatcgcggctgctattgctgatgaa
acaaaatactctaaaaaacaagtcatagcgaagctggacgatgaaacatttatcaatcag
ctgaagaaagaattcccggacactgtgacaaatgatgttttcaataaaaacattaagcac
ccgcttgaagggtacctattcccggctacatacccttttaacgatccggacacatcactt
gaagacattatcaaggcaatgattaagcagacaaattcttatgtggaaacatataaatca
gaaatgaagaaaaacaaagtttctgtgcataagctgctgacaatggcttctttgatagaa
gaagaagcgactgaaaaagccgaccgccataaaattgcgagcgtcttttataaccgcctg
aaaaagaaaatgccgctccaaacagatccgaccgtcctgtacgcggcaggcaagcataaa
gatcgggttctttataaggatctggaaatcgattcaccatacaatacgtataaaaacaca
gggctgacgccagggccgattgccaatgccggcatgtcatcatgggaagcagcgctgcat
ccggataaaacggactatctgtatttcttggccaaatcaaatggtgaggtcgtatttaca
aaaacgctaaaagagcataataaagcaaaagaaaaatacatttcctcaaaaaatgagaaa
taa

DBGET integrated database retrieval system