KEGG   Bacillus subtilis subsp. subtilis 168: BSU27380
Entry
BSU27380          CDS       T00010                                 

Symbol
yrzB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1292 DUF6774
Other DBs
NCBI-GeneID: 938000
NCBI-ProteinID: NP_390616
Pasteur: BG13812
BSORF: BG13812
UniProt: O34828 A0A6M4JJT6
Position
complement(2797100..2797381)
AA seq 93 aa
MEHGEKNITIVDDQGNEQLCEVLFTFENEEFGKSYVLYYPIESKDDEEVEILASSFTPNE
DGENGELFPIETDEEWDMIEETLNTFLADEDEE
NT seq 282 nt   +upstreamnt  +downstreamnt
atggaacacggcgaaaaaaatattacaattgttgacgatcaaggaaatgaacagctttgt
gaagtgctgtttacatttgaaaatgaagagtttggcaaatcttatgtcttgtactatcca
atcgaatcaaaagatgacgaagaagtagaaattcttgcttccagcttcacgccaaacgaa
gacggtgaaaacggtgagctattcccgattgaaactgacgaagaatgggatatgatcgaa
gaaacactaaacacattcttagcggacgaagacgaagagtaa

DBGET integrated database retrieval system